KEGG   Enterococcus faecalis V583: EF1883
Entry
EF1883            CDS       T00123                                 

Definition
(RefSeq) hypothetical protein
Organism
efa  Enterococcus faecalis V583
SSDB
Motif
Pfam: TrbC Flp_Fap MS_channel Wzy_C
Other DBs
NCBI-GeneID: 1200763
NCBI-ProteinID: NP_815566
UniProt: Q81ZJ6
Position
complement(1828948..1829169)
AA seq 73 aa
MNFGQNLYQWFLTNAQSLVLLAIVVIGLFLGFKREFSKLIGFLVIALIAVGLVFNASGVK
DVLLNLFNRIVGA
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaatttcggacaaaatttgtatcaatggtttctaaccaatgcccaatccttagtctta
ctggcaattgtggtcattggtttgtttttaggatttaagcgggagttttctaaattgatt
ggcttcctggtgattgccttgattgcggtaggtctggtctttaatgcttctggtgtaaaa
gatgtcttactcaatttattcaatcgaatcgtcggtgcgtaa

DBGET integrated database retrieval system