KEGG   Enterococcus faecalis V583: EF2278Help
Entry
EF2278            CDS       T00123                                 

Definition
(RefSeq) NLP/P60 family lipoprotein
Organism
efa  Enterococcus faecalis V583
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysozyme_like NLPC_P60 DUF1175 SLT CHAP
Motif
Other DBs
NCBI-GeneID: 1201150
NCBI-ProteinID: NP_815935
UniProt: Q832F2
Position
complement(2198027..2199049)
Genome map
AA seq 340 aa AA seqDB search
MTIKKLSTVLLVLLTVLFMGILICVGLLFGDDSEGNSSTGLSSGGSNVSLEVLKHRPLVE
KYAKESDILEYVPILLAIIQVESGGTMEDVMQSSESAGFPPNSLSTEASIKQGCIYFASL
VNRAKDIGCDQESIIQSYNYGGGYLDYVGKNGKKYSFALAESFSKEKSDGEKVTYSNPIA
IKENGGWRYNYGNMFYVMLVKQYLTTTKFDDKTVQGIFDEAFKYEGTAYVFGGSSPATGF
DCSGLTQWCYAKVGLQLPRVAQDQYDAMSHIELKDAKPGDLIFFHSTYDAGTYVTHVGIY
AGDNRMFHAGDPVGWTNLTETYWQQHIIGAGRYKNRKGDR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaaaaagttaagtaccgttctattagttcttttaacggttttgtttatggga
attttgatttgtgtcggtctattatttggtgacgatagtgaaggaaatagcagtactgga
ttgtcctctggagggagtaatgtttccttagaagttttaaagcatcgtccacttgtagag
aagtatgctaaagaatcggatattttagagtatgttccgattcttctagcaattattcag
gtagagtctggcggtacgatggaagatgtgatgcaaagttctgaatcagcgggattccca
cctaactcgttaagcaccgaagcttcaatcaagcaagggtgcatttattttgcttcctta
gtcaatcgagcaaaggatatcggttgtgatcaagagagcatcattcaatcgtataactat
ggtggtggatatttagactatgttggaaaaaatggaaagaagtacagctttgccttagcg
gaatctttttcaaaagaaaaatcagatggggaaaaagtgacctattcgaatccaatcgct
attaaggagaatggtggttggcgttataactatggaaatatgttttatgtaatgttagtg
aaacaatatcttactacaacgaagtttgatgataaaaccgttcaaggaatttttgatgaa
gcttttaagtatgaagggacggcatatgtgttcggaggttcaagtccagcaacaggtttt
gattgtagcggattaacgcagtggtgttatgccaaagttggtttgcaacttcccagagtc
gcgcaggatcagtatgatgctatgtctcatatcgagttgaaagatgctaagccaggagat
ttaattttctttcactcaacgtatgatgcaggaacttatgtgacacatgtaggtatctat
gctggagacaatcggatgttccatgcaggtgatcccgttggatggactaatcttaccgaa
acttattggcagcaacatatcattggtgctggtcggtataaaaatagaaaaggggacaga
tga

DBGET integrated database retrieval system