KEGG   Enterococcus faecalis V583: EF2280Help
Entry
EF2280            CDS       T00123                                 

Definition
(RefSeq) hypothetical protein
Organism
efa  Enterococcus faecalis V583
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10 DUF853 DUF3461
Motif
Other DBs
NCBI-GeneID: 1201152
NCBI-ProteinID: NP_815937
UniProt: Q832F0
Position
complement(2201166..2203613)
Genome map
AA seq 815 aa AA seqDB search
MYPIKYIENNLVFNQEGECFAYYELIPYNYSFLSPEQKYQLHDNFRQLIAQNREGKIHAL
QIATESSIRATQERSKKEVIGRLKEIALQRIDLQTDALVSMIGDSQIDYRFFIGFKLIAT
DEEVNLKSLKKSFFSGFQEFIYEVNHHLMGDFVSLSNEEIRRYTKLEKLMESKLARRFKV
RRVNPSDLTYLIEHIYGEKGTPFEEYAFQLPKKKLKSETLVKRYDLLRPSRCLIEEKPRY
LRIEHENHESYVTYLTINTIVGEMEFPSSELFYYQQQQFAFPIDTSMNVEIVTNKKALAI
VRNKKKELKDLDNHAYQSDNETNSNVLDALDSVDELETTLDQSKESMYKLSYVVRVRAES
VDELKRRCDEVFDFYDDTNVKLVRPFGDTMGLHEEFLPASKRYMNDYIQYVTSDFLAGLG
FGATQMLGELEGIYFGYNADTGRNVYLKPALASQGVKGSVTNALAAAFLGSLGGGKSFSN
NLLVYYAVLFGGQAVIVDPKGERGGWKENLPEIADEINILNLTSKPENQGLLDPYVIMKK
KKDSESLAIDILTFLTGISSRDGEKFPVLRKAIRTVTQSDQRGLLQVINELRKENSPVAE
NIADHIESFTDYDFAHLLFSDGSITQSISLDKQLNIIQVADLVLPDAETTFEEYTTMELL
SVSMLIVISTFALDFIHSNREIFKIVDLDEAWSFLQVAQGKTLSNKLVRAGRAMNAGVYF
VTQNSDDLLDERLKNNIGLKFAFRSTDIHEIKKTLEFFGLDQEDESNQKRLRDLENGQCL
MQDLYGRVGVVQVHPVFEELFHAFDTRPPVQERME
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgtacccgattaagtatatcgaaaataatcttgtttttaatcaagaaggagagtgtttt
gcttattatgagttaataccttataactattccttcttatctcctgaacaaaaatatcaa
ttgcatgataatttccgccaattgattgcccaaaatcgagaaggtaagattcatgcgcta
caaattgcgacagaaagtagtattcgtgccactcaggaacgatctaaaaaggaagttata
ggtagactcaaagaaatagcattacaacggattgatttacagacagacgcattagtatcc
atgattggcgatagtcagattgattatcgcttttttattggtttcaaactgattgctaca
gatgaagaagtgaatttgaaaagtctcaaaaaatccttcttttccggctttcaagagttt
atctatgaggtcaatcatcatttgatgggcgattttgtttcattatcaaatgaagaaatt
cgccgatataccaagcttgaaaaactgatggaaagtaaattagcgcggagattcaaagtc
agacgagtgaatcccagtgatcttacttacttgattgaacatatttatggcgaaaaaggt
acaccgtttgaagaatacgcctttcagttaccaaagaaaaaattgaaatcagaaactttg
gtgaaacgctatgacttattacgtcccagtcgttgtttgattgaagagaaacctcgttac
ttaaggattgaacatgagaatcatgagtcttatgtaacctatttgacaattaataccatt
gtcggggagatggagtttccttcctcagagcttttctattaccagcaacaacaatttgct
tttccgattgatacttcaatgaatgtagaaattgtcaccaataaaaaggcattagctatc
gttcgcaacaagaaaaaggaattaaaagatttagacaaccacgcttaccaatctgacaat
gaaacgaattccaatgttttggatgctttggattccgttgatgaattggagaccaccttg
gatcagtcaaaagaatccatgtacaaattgagctatgtggtccgggtgagagcagaatca
gtggatgaactaaaacgccgttgtgatgaagtgttcgatttttatgatgataccaatgtg
aaactagtccggccctttggcgatacgatggggctacatgaagaattcctaccagctagt
aaacggtatatgaatgactatatccagtatgtaacatctgactttttagcaggacttggc
tttggcgccactcaaatgttaggagagttggaagggatttactttggctacaatgcggat
acggggcgtaatgtttacctgaaacccgcattagcctcacaaggagtaaagggctcagta
accaatgcattagctgcggcttttcttggttctcttggtggcggaaaatcctttagtaac
aatctcttggtctactatgctgttctttttggtggccaagctgtgattgtcgatccaaaa
ggagaacgaggtggttggaaagaaaacttgccagaaattgcggatgaaatcaatattctc
aacttgactagtaaaccagaaaatcaaggcttacttgatccttatgtgattatgaagaaa
aagaaagattcagaaagtttagcaattgatatcctgacttttttaacaggaatttccagt
cgggatggggagaagtttccagtattgcgcaaagccattcggacggttacccaaagtgat
caacgaggattgctgcaagtcattaatgagcttcgaaaggagaactctccagtcgcggaa
aatatcgccgatcatatcgagtcctttaccgattatgattttgcccatttgcttttctca
gatggttcgattacccaatcaattagtttagataagcagttgaatatcattcaagtagcg
gatttggttttaccagatgcagaaaccacttttgaagaatataccacgatggagttgcta
agtgtctctatgctaatcgtcatttccacgtttgccttggattttatccatagtaatcga
gaaatcttcaagattgtggacctggatgaggcttggagttttcttcaagtggctcaagga
aagaccctttcaaataagctcgttcgtgctggtcgggccatgaatgccggtgtttacttt
gtcacgcaaaatagtgacgatttactggatgaacgcttgaagaataatatcggattgaaa
tttgcttttcgtagtaccgatattcatgaaatcaagaagactttggaattttttgggttg
gatcaagaagatgaaagtaatcaaaaacgcctacgagatttggaaaacggccaatgcttg
atgcaggatttgtatggtcgggtaggtgtggttcaggttcacccggtctttgaagaactc
ttccatgcctttgatactcgcccaccggttcaagagagaatggagtga

DBGET integrated database retrieval system