KEGG   Enterococcus faecalis V583: EF2416Help
Entry
EF2416            CDS       T00123                                 

Gene name
rpsU
Definition
(RefSeq) 30S ribosomal protein S21
  KO
K02970  small subunit ribosomal protein S21
Organism
efa  Enterococcus faecalis V583
Pathway
efa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:efa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EF2416 (rpsU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:efa03011]
    EF2416 (rpsU)
Ribosome [BR:efa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    EF2416 (rpsU)
  Bacteria
    EF2416 (rpsU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S21
Motif
Other DBs
NCBI-GeneID: 1201283
NCBI-ProteinID: NP_816065
UniProt: Q831T3
Position
complement(2336159..2336335)
Genome map
AA seq 58 aa AA seqDB search
MSKTVVRKNESLDDALRRFKRSVSKAGTLQESRKREFYEKPSVKRKKKSEAARKRKKF
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacagtcgttcgtaaaaacgaatctcttgatgatgctcttcgtcgcttcaaa
cgttccgtttcaaaagcgggtactttacaagaatcacgtaaacgtgaattctacgaaaaa
ccaagtgtaaagcgtaagaaaaaatctgaagcagctagaaaacgtaaaaaattctag

DBGET integrated database retrieval system