KEGG   Enterococcus faecium Aus0085: EFAU085_00435Help
Entry
EFAU085_00435     CDS       T02788                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
efau  Enterococcus faecium Aus0085
Pathway
efau00010  Glycolysis / Gluconeogenesis
efau00020  Citrate cycle (TCA cycle)
efau00620  Pyruvate metabolism
efau01100  Metabolic pathways
efau01110  Biosynthesis of secondary metabolites
efau01120  Microbial metabolism in diverse environments
efau01130  Biosynthesis of antibiotics
efau01200  Carbon metabolism
Module
efau_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU085_00435
   00020 Citrate cycle (TCA cycle)
    EFAU085_00435
   00620 Pyruvate metabolism
    EFAU085_00435
Enzymes [BR:efau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     EFAU085_00435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_29
Motif
Other DBs
NCBI-ProteinID: AGS74391
Position
452759..454396
Genome map
AA seq 545 aa AA seqDB search
MSTKESLELNEITSGNPLLSSIRSIVETTFYGNNVHEVFDRKTAYQLAKGSPGTIITDLT
ISHAEELDLPADVRTLVFNDGSIVGRTASARRIFEDLDKEQSKYEKILREAVYQSRKRQF
YHTKVIVGLSEEFSVQSHLLIPEGFENNLYSYLLNFQPANSKILETYQKSVSFDEGDLYI
FCDPEWTHETFPNGLILFDALHNTAAVLGLRYFGELKKATLTLAWALGNRNGFIACHGGM
KQYASNDQTYTMAVFGLSGSGKSTITLAKHTEGHSVSILHDDAFVISRKNGFATALEPSY
FDKTQDYPSDDPAISSFLTCQNVGVTCTSKGEKVLVTGDIRNGNGRTVKSRYATPDRVDH
LSEKIDAVFWIMKDDSLPPIIKINDPVLAASFGATLATKRSDAENITTKRQLDELVIEPF
ANPFRVYPLREDYQAFRELFLKQQTACYVLNTGYFDDKKIKPETTLSIVERIVQQTAEFK
SFGPFEDIHYLPIPDFPVSFEDTSYKNLVKQRLDIRLRFIEAQIGKDLLLDEAKESLENL
IQKLN
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaaaagagagtctcgaattaaacgaaatcacaagtggaaatccactgttatcc
agtattcgatcgattgtagaaacgacattttacggtaataatgttcatgaagtttttgac
aggaagacagcttatcaactagcaaaagggagtccaggaacgatcatcacagatttaaca
atctcacatgctgaagaactagatttaccagctgatgttaggacactagtattcaatgat
ggaagcattgtgggaagaacagcaagtgctcggcggatctttgaggacttagacaaggaa
caaagcaaatacgagaaaattttaagagaagctgtgtatcaaagtcgcaagcgccagttt
taccatacaaaagtaatcgttggcctatctgaagaattttctgtgcaaagtcatttgctg
attccagaaggatttgagaacaatttgtattcttatttgctgaattttcagccagcgaat
tcgaagatcttagagacttatcaaaagtctgtttcctttgatgagggagatctttatatc
ttttgtgatcccgaatggacacatgaaacatttccaaatggactcattttgtttgatgct
ctccataatacagcggctgtgctaggattacgttactttggagaattaaaaaaagcgact
ttgacgcttgcttgggcattgggaaatcgcaatggctttattgcctgccacggtgggatg
aaacaatatgctagtaatgaccagacctatacgatggctgtatttgggttgtccggttct
ggaaaatcaacgattaccttagcaaaacatacggaaggtcactctgtttcgatcttgcat
gacgatgctttcgttatttctcgaaaaaatggttttgctactgccttggaaccttcttac
tttgataaaacacaagactatccgtctgatgatccggccatttcttctttccttacttgt
cagaatgtgggcgtgacatgtacaagtaaaggagaaaaagtcctagtaacaggagatata
cgaaacggaaatgggcggacagtcaaatcacgttatgcgacacccgaccgagtcgatcat
cttagcgaaaagatcgatgctgttttttggatcatgaaagatgattcgcttccgccaatt
atcaagatcaatgacccagttttagcagcgtcttttggtgcaacattagcaacaaaacga
tcagacgcggaaaatatcactacaaaaagacagctagatgagctagtcattgaaccattt
gctaatcctttccgtgtctatcctcttagggaagactatcaagcttttcgagagttgttt
ttgaaacagcaaacagcctgctatgtcctgaatactggatatttcgatgataaaaaaatc
aaacctgaaacgacattgtcaatcgttgaaagaatcgtgcaacaaacggcagaattcaag
tcgtttggtccatttgaagacatccactatttacctataccagattttcctgtttctttt
gaggatacgtcctataaaaatctggtgaaacaacgacttgatattcgtttacgattcatt
gaagctcagataggaaaagatctcttgctagatgaagcaaaagaaagtttggagaatttg
attcagaaattgaactaa

DBGET integrated database retrieval system