KEGG   Enterococcus faecium Aus0085: EFAU085_01370Help
Entry
EFAU085_01370     CDS       T02788                                 

Gene name
fhs2
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
efau  Enterococcus faecium Aus0085
Pathway
efau00670  One carbon pool by folate
efau01100  Metabolic pathways
efau01120  Microbial metabolism in diverse environments
efau01200  Carbon metabolism
Module
efau_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:efau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EFAU085_01370 (fhs2)
Enzymes [BR:efau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     EFAU085_01370 (fhs2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AGS75324
Position
1386353..1388023
Genome map
AA seq 556 aa AA seqDB search
MKNDLQISQETELEPIVEVASKLDLKEDDLELYGKYKAKINFSGINRSKDNAEGHLILVT
SINPTPAGEGKSTITVGLGDALNKINKKSVIALREPSLGPVMGIKGGAAGGGYAQVLPME
DINLHFTGDMHAITTANNALSALLDNHIHQGNELNIDARRVIWKRVVDLNDRELRKVIVG
LGGPIQGVPREDGFDITVASEIMAILCLAADLEDLKARLARIVVGYTFDRQPVTAGDLKA
EGALALLLKDAIKPNLVQTIYGTPAFVHGGPFANIAHGCNSILATKTALRLADYVVTEAG
FGADLGGEKFLDIKVPNLKKAPDAVVIVATVRALKMHGGMKKDELKNENLDALKVGFANL
KRHIRNMEQYQLPVIVAINEFVTDTDNELTLLEHLCENQGILAKRASVWADGAEGGVDLA
KAVVRLIDRKEANYKPLYRLEETIQEKTETIVKKIYGGNGVVFSKKAQKQIEEFTKNGWD
KLPICMAKTQYSFSDDPSLLGAPEDFTITIREIIPKLGAGFLVALTGDVMTMPGLPKKPA
ALNMDVTNDGEVLGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgatctgcaaatttcacaagaaacagagctagaaccgattgttgaagtggct
agtaaattagatcttaaggaagacgatttggaactgtatgggaaatataaggcgaaaatc
aatttttctggaatcaatcgatcaaaggataacgctgaggggcatttgatcttagttact
tccatcaatccaacaccagctggcgaaggaaagtcaacgatcactgtagggttaggagac
gcgctcaataaaatcaataaaaaatctgttattgcattgcgagaaccctcacttggtcct
gtgatgggaatcaaaggtggtgctgcaggcggaggatatgcacaggtattgcctatggaa
gatatcaacttgcattttactggtgacatgcatgctatcacaacagctaataatgcatta
tctgctcttttagataatcatattcatcaaggaaatgaattgaacatcgatgcccgccga
gtgatttggaaacgggtagtcgatctcaatgatcgtgaactgcgtaaagtaattgttggc
ttgggtgggccaatccaaggtgttccaagagaagatgggtttgatatcacagttgccagc
gaaatcatggctatcttgtgtcttgcggcagaccttgaagatttaaaggctcgtcttgca
aggatcgttgtcggctatacatttgaccgtcagcctgtgactgctggagacttgaaagca
gaaggcgctctggcattactgctgaaagatgcaatcaagccgaatcttgtacaaacaatt
tacggaacaccagcttttgtccacgggggaccgtttgccaatatcgctcatggctgcaat
agtattttagctaccaagacagcattgagattagcagattacgttgtcacagaggcagga
tttggtgcagatcttggcggagagaaatttttagatatcaaagtacctaacttgaaaaaa
gcgccggatgctgtggtgattgtcgccactgtccgtgcattgaaaatgcatggcggaatg
aaaaaagatgaacttaaaaatgagaatcttgatgctttgaaagtaggttttgcaaattta
aagcgccatatacgtaatatggaacaatatcagctacctgtgatcgtcgcaatcaatgaa
ttcgtaacagatacagacaatgaactcacactgttggagcacttgtgtgaaaatcagggg
attcttgccaagagagcgagtgtatgggcagatggagcagaaggcggcgttgatttagca
aaagctgtagtacgattgattgatagaaaagaagctaattacaagccattataccgccta
gaagaaacgatacaagaaaagacagaaacaatcgtcaagaaaatttacggaggaaatggt
gttgttttcagcaaaaaagcgcaaaaacaaatagaagagtttacgaagaatggatgggac
aaactgccgatttgtatggcaaaaacacagtattcattttctgatgatccttcactgcta
ggtgcaccggaagatttcaccatcacgatccgcgaaatcatcccaaaattaggggcagga
tttttagtagccttgactggagatgttatgacgatgcctggtttgcctaaaaaacctgct
gcattgaatatggacgtgacaaatgacggagaagtgttgggattgttttaa

DBGET integrated database retrieval system