KEGG   Enterococcus faecium Aus0085: EFAU085_02337Help
Entry
EFAU085_02337     CDS       T02788                                 

Gene name
metG
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
efau  Enterococcus faecium Aus0085
Pathway
efau00450  Selenocompound metabolism
efau00970  Aminoacyl-tRNA biosynthesis
efau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EFAU085_02337 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EFAU085_02337 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:efau01007]
    EFAU085_02337 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:efau03016]
    EFAU085_02337 (metG)
Enzymes [BR:efau01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EFAU085_02337 (metG)
Amino acid related enzymes [BR:efau01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EFAU085_02337 (metG)
Transfer RNA biogenesis [BR:efau03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EFAU085_02337 (metG)
 Prokaryotic type
   Other AARSs
    EFAU085_02337 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AGS76291
Position
complement(2340591..2342600)
Genome map
AA seq 669 aa AA seqDB search
MAEKETFYITTPIYYPSGKLHIGNSYTTIACDAIARYKRLMGFDVFYLTGVDEHGQKIET
KAEELGVKPQEYVDKMAADVKKLWKTLDISYDKFIRTTDDYHKAAVQKIFDRLLEQGDIY
LGEYEGWYSVSDEEFFTETQLAEVYKDDEGNVIGGKAPSGHEVELVKEESYFFRMSKYAD
RLLEYYEEHPEFIQPESRKNEMINNFIKPGLEDLAVSRTTFTWGVPVKSDPKHVVYVWID
ALSNYITALGYGSEDESLFEKYWPADVQMVGKEIVRFHTIYWPIMLMALDLPLPKKVFGH
GWLLMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLLRAVPFGSDGVFTPEDFVSRVNYD
LANDLGNLLNRTIAMINKYCDGLVPDYASLVTPFDSELSTTAANVVGRYHDAMEKMEFNT
ALAEIWVLISRANKYIDETEPWVLAKDEEKKAELNSVMIHLAESLRIAAILLQPIMTETP
EKIFNQLGLDSETMNLEGLHFGEFPSGTKVVAKGTPIFPRLDMEEEVAFIQEKMSEGTQT
NEDTVKWDPEETELVSTKEKQIKFDVFEKVELKVAEVINCQKVEGADKLLQFRLDAGDSQ
DRQILSGIAEFYPDPSELIGKKVVIVANLKPRKMRGQISQGMILSAEAPDGSLQVIEAPK
SMPNGSEIA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaaaggaaactttttatatcactacgccaatctattatccaagcggcaaactt
catatcggcaactcgtatactacgattgcatgtgacgcaattgctcgttataaacggttg
atgggctttgatgtgttttatctcactggagtggatgaacatggtcaaaaaatcgaaaca
aaagcagaagaactaggtgtaaaaccgcaagaatatgtagataaaatggcggctgatgtc
aagaaattatggaaaacgcttgatatcagttatgataaattcattcgcacgacagatgat
taccataaagcagctgttcaaaaaatatttgatcgtttattagaacagggagatatttac
ttaggtgaatatgaaggctggtactctgtttctgacgaagaattctttacagaaacacaa
cttgcagaagtgtacaaagatgacgaaggtaacgtgatcggtggtaaagcgccaagtgga
cacgaagtagaattggtaaaagaagaatcatacttcttccgcatgagcaaatacgcagac
cgtctattggaatactatgaagaacatcccgaattcatccagccagaatctcgtaaaaac
gaaatgatcaacaactttatcaaaccaggattagaggatcttgcagtttcacgaacaact
tttacttggggagtaccagtcaagagtgatccgaaacatgtggtgtatgtatggatcgat
gcattatccaattatattactgcactaggatatggctccgaagatgaaagtctattcgaa
aaatactggcctgcagatgttcagatggtcggtaaagaaatcgttcgctttcatacgatc
tattggccaatcatgctgatggcccttgatttgcctctacctaaaaaagtatttgggcat
ggctggctattgatgaaagacggaaaaatgtctaaatcaaaaggaaatgtcgtttatcct
gaaatgcttgtggaacgttatggtttagatgcactccgttattatttgcttcgtgctgtt
ccgtttgggtcagatggtgtctttacgccagaagattttgtttcccgtgtcaattatgat
ctggcaaatgatctagggaacttattgaatcgaacgattgctatgatcaacaaatattgt
gatggactcgttcctgactatgcctcacttgtcactccatttgatagtgaactgtctacg
acggctgctaacgttgtcggacgttaccatgatgcaatggaaaaaatggaattcaataca
gcattggctgaaatctgggtgctgatttctcgtgcaaacaaatacattgatgaaacagaa
ccatgggtattagcaaaagacgaagaaaagaaagctgaattgaatagtgtcatgatccat
ttagctgaatctttgcgtatcgcagcgatattacttcagccaatcatgacagaaacgcca
gagaagatcttcaatcaactaggattggactctgaaacaatgaatcttgaaggattacac
tttggcgaatttccttcaggaacaaaagtagttgcaaaaggtacaccaatcttcccacgt
ttagatatggaagaagaagttgcttttattcaagaaaaaatgtctgaaggtactcaaaca
aacgaagatacagtcaaatgggatccagaagaaacagaacttgtttcaacgaaagaaaaa
caaatcaaatttgatgtatttgaaaaagtagaactaaaagtagcagaagtcatcaactgt
caaaaagtagaaggggcagataagttgctgcaattccgactagatgctggagacagccaa
gaccgtcaaatcttgtcaggaatcgctgaattttatcctgatccaagcgaattgatcggg
aaaaaagtcgtcattgtagcaaatctgaaaccacgaaagatgcgtggacaaatcagtcaa
ggaatgatcctttctgcagaagcaccagatggctctttacaagtaatcgaagcaccaaaa
tccatgccaaatggctcagaaatcgcatag

DBGET integrated database retrieval system