KEGG   Enterococcus faecium Aus0085: EFAU085_02553Help
Entry
EFAU085_02553     CDS       T02788                                 

Definition
(GenBank) methyltransferase domain protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
efau  Enterococcus faecium Aus0085
Brite
KEGG Orthology (KO) [BR:efau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:efau03009]
    EFAU085_02553
Enzymes [BR:efau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     EFAU085_02553
Ribosome biogenesis [BR:efau03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EFAU085_02553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 MetW Methyltransf_4 Methyltransf_23 Methyltransf_12 Methyltransf_18 Pox_MCEL MTS Ubie_methyltran RPA_interact_C
Motif
Other DBs
NCBI-ProteinID: AGS76507
Position
complement(2542081..2542947)
Genome map
AA seq 288 aa AA seqDB search
MLKKIDRGRQFLAENHQLFRCPVCQEEVKKSDNGLICKNNHRFDLSKKGTLYFLSHAVKT
EYDQGMFVPRRRMIQSGMYQPVIETIAQHLPEEVSLLDVGCGEGSFLNELSKLKKIQNAV
GFDISKEGVYAATEQSAEAFWCVADLTNLPFADQTFNAVLNIFSPSHYQEFQRVLSEDGE
VLKVVPQENYLKELRQAFYPNQPEKQSYSNERVVAKFAEAMKLTERQRVTYEFEIPEENQ
KDLLAMSPLEWQVEERIKADLYKNPLKKITIDIELLKGTKRKRFSSSF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaattgaccgaggacgccagtttttggcagaaaatcatcagctgttccgc
tgtccggtttgccaagaagaagtaaaaaagtctgataatggcttgatatgcaaaaataat
caccgttttgacctttccaaaaaaggaacactttattttttatcccatgcggttaaaaca
gaatacgatcaaggaatgttcgttccaaggcgtagaatgatccaatctggcatgtatcag
cccgttattgagactattgcgcagcatttacctgaagaagtctcgctattagatgttggc
tgcggagaaggtagcttcttgaatgaactttcaaaattgaaaaagattcaaaatgctgtt
ggatttgatatttcaaaagaaggagtctacgcagctacagaacaatctgccgaagcattt
tggtgtgtagctgatttgaccaatttgccgtttgctgatcaaacattcaacgcggtttta
aatatcttttcgccttctcattaccaagaattccaacgtgtactctcagaagatggagaa
gtgttgaaggtggtgccacaagaaaattatttaaaggaactacgtcaggctttttatccg
aatcaacctgaaaaacagagttattccaatgaacgtgtagtagccaagtttgctgaagca
atgaaattaactgaacgtcagcgtgtaacctatgaatttgagataccagaggaaaatcaa
aaagatcttttggccatgtcacctttagaatggcaggtagaagagcgaatcaaagcagac
ttatataagaatcctttgaagaagattacaattgacatagaattattaaaaggaactaag
agaaaacgtttttctagcagtttttaa

DBGET integrated database retrieval system