KEGG   Enterococcus faecium Aus0004: EFAU004_01240Help
Entry
EFAU004_01240     CDS       T01772                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00280  Valine, leucine and isoleucine degradation
efc00650  Butanoate metabolism
efc00900  Terpenoid backbone biosynthesis
efc01100  Metabolic pathways
efc01110  Biosynthesis of secondary metabolites
efc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:efc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EFAU004_01240
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    EFAU004_01240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EFAU004_01240
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EFAU004_01240
Enzymes [BR:efc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     EFAU004_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFC63325
Position
1273159..1274313
Genome map
AA seq 384 aa AA seqDB search
MKIGIDRLSFFIPNLYLDMTELAESRGDDPAKYHIGIGQDQMAVNRANEDIITLGANAAS
KIVTEKDRELIDMVIVGTESGIDHSKASAVIIHHLLKIQSFARSFEVKEACYGGTAALHM
AKEYVKNHPERKVLVIASDIARYGLASGGEVTQGVGAVAMMITQNPRILSIEDDSVFLTE
DIYDFWRPDYSEFPVVDGPLSNSTYIESFQKVWNRHKELSGRGLEDYQAIAFHIPYTKMG
KKALQSVLDQTDEENQERLMARYEESIRYSRRIGNLYTGSLYLGLTSLLENSKSLQPGDR
IGLFSYGSGAVSEFFTGYLEENYQEYLFAQSHQEMLDSRTRITVDEYETIFSETLPEHGE
CAEYTSDVPFSITKIENDIRYYKI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagggattgatcgtctttccttttttattcctaatttatatttagatatgaca
gagttggcagaaagccgtggggatgatcctgcaaaataccatatagggattggtcaagac
caaatggcagtcaatcgtgcaaatgaagacatcattacactaggagcaaatgctgccagc
aaaatcgtaacagaaaaagaccgtgagctaatcgacatggtcatcgtcggaacagaatcc
gggattgatcattcaaaagcgagtgcggtaattatccaccatttactgaaaatccaatct
tttgctcgttcttttgaagtaaaagaggcttgctacggtggcaccgcagctttgcacatg
gcgaaagaatatgtcaaaaatcatccagaacgaaaagtactagtcatagcaagtgatatt
gctcgttacggcttggcaagcggtggtgaagtgacgcaaggtgtcggtgctgttgcgatg
atgatcactcaaaacccgcgtattttatcgattgaagacgacagcgtatttctgacagaa
gatatctatgatttctggcgtccagattatagcgaatttcctgttgttgatggtccttta
tctaattctacgtatatcgaatcattccaaaaagtttggaatcgacataaagaattgtcg
ggtcgaggactcgaagattatcaggcgattgctttccatattccgtatactaagatggga
aaaaaggcattgcaaagcgtattagaccaaacagacgaagaaaatcaggaacgtcttatg
gctcgctatgaagaaagcatccgttacagccgacgaatcggtaatctttacactggttca
ttatacctggggctaacttctctactggaaaattcgaaatcactacagccaggagatcgc
atcggtctattcagctacggttctggtgcagtaagtgaattttttacaggttatctggaa
gaaaactatcaagaatatctcttcgcacaatctcatcaagagatgctagattctcgaaca
cggatcactgttgacgaatatgaaacgattttcagtgagacgcttcctgaacacggagaa
tgtgcagaatatacttcagatgtacctttttcgattacaaagatcgaaaatgatattcgt
tactacaaaatataa

DBGET integrated database retrieval system