KEGG   Enterococcus faecium Aus0004: EFAU004_02072Help
Entry
EFAU004_02072     CDS       T01772                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00300  Lysine biosynthesis
efc01100  Metabolic pathways
efc01120  Microbial metabolism in diverse environments
efc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EFAU004_02072
Enzymes [BR:efc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     EFAU004_02072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AFC64156
Position
complement(2096709..2097848)
Genome map
AA seq 379 aa AA seqDB search
MKKEEKIAILQEIIRIKSVNGNEGEVAAYLNKLLAKHDITGEIVSYRDGRDNLIARYQKG
QSGKVLGLSGHMDVVAAGDESSWTYAPFAAEIHGNRLYGRGATDMKSGLAAMVIAMIELK
ESGKPFNGTVKLLATVGEEVGELGGEQLTKAGYVDDLDALIIGEPTNYSLMYTHMGSINY
TVTSHGKEAHSSMPDQGYNAINHLNEFITKANAEMNHLAETIENPVLGKTIHNVTLISGG
NQVNSIPSHAQLQGNIRSIPEYPNDKIIALLQSIVNELNQETDYHLELMIDYNKIPVKAD
PDSPLIHCIQQQFSQPLPLVGAAATTDAAEFTKANHSFDFVVFGPGVVTLPHQVDEYVEI
DNYLDMIEKYQGIILSYLA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaagaaaaaatcgcgattttacaagagatcatccgaattaaatcagtgaat
ggaaacgaaggtgaagtagcagcctatttgaataagcttttggcaaagcatgacataaca
ggagagattgtttcttacagagatggtagagataatttgattgctcgttaccaaaagggc
caatcaggaaaagtgttaggcctatctgggcatatggatgtcgtggcggctggtgatgaa
tcgtcttggacctatgcaccctttgcagcagaaatccatgggaaccgtttgtacggacgt
ggtgctacagatatgaagagtggcttggcagcaatggtgattgccatgatcgaactgaaa
gagtcaggaaaaccatttaacggaacagtcaaattattagccactgtcggagaagaagtg
ggtgaactaggtggggaacagctcacgaaagcaggctatgtagatgacttagatgccttg
atcatcggagagccaactaattacagtttgatgtatacgcacatgggatcaatcaactat
acagtcacctcgcacggaaaagaagcgcatagctctatgccagaccaaggttataatgca
atcaatcacctaaatgaattcattacgaaagcaaatgctgaaatgaatcacctcgctgaa
acaatcgagaatcctgtcctaggaaaaacaatccataatgttacattgatcagtggcggg
aatcaagtcaacagcatcccaagccatgcgcagctccaagggaacattcgatcgattcca
gaatacccaaatgataaaatcattgcattgctgcaatcaatcgtcaatgaattgaatcaa
gagacagactatcatttggaattgatgatcgattacaacaaaatacctgtcaaagctgat
ccagattctcctttgattcattgcattcagcaacaattcagccagccattacctttagtt
ggagcggcagcaacaacggatgcagccgaatttacgaaagctaaccattccttcgacttt
gtcgtctttgggcctggtgtcgttactttgcctcatcaagtagatgagtatgttgaaatc
gataattatttggatatgattgaaaaatatcaaggaattattttatcctacttagcgtaa

DBGET integrated database retrieval system