KEGG   Enterococcus faecium Aus0004: EFAU004_02228Help
Entry
EFAU004_02228     CDS       T01772                                 

Definition
(GenBank) HAD superfamily hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00627  Aminobenzoate degradation
efc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:efc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EFAU004_02228
Enzymes [BR:efc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     EFAU004_02228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AFC64311
Position
complement(2258024..2258788)
Genome map
AA seq 254 aa AA seqDB search
MDYKGYLIDLDGTIYRGTQPIPAGKRFVEELQKRKLPFLFVTNNTTKSPETVANRLADEF
DIHVAPETVYTATLATIDFMKADGKGKKVYVIGEAGLIDLILAAGFTWEEEAPDYVVVGL
DNYLTYEKVVKATLAIQKGATFIGTNPDKNIPTERGLLPGAGSVISFVETATQTPPIYIG
KPEAIIMDKAVEVLGLQKEEVIMVGDNYETDIQAGIRNNIDTLLVLSGFTKEEDVPGLPI
PATYVKQSLDEWSF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggactataaaggatatttaattgatttagacggaacgatttatcgtgggacacaaccc
ataccggccggtaaacgatttgtggaagaattgcaaaaaagaaaattacctttcttgttt
gttaccaataacacgactaagtcaccagaaacagtagctaatcgtctagcagatgagttt
gacattcatgtagctccagagacagtctacacagctactttggcaacaatcgattttatg
aaagcagatggaaaagggaaaaaagtctatgttatcggagaagcaggattgattgacttg
attttagctgccggatttacatgggaagaagaggctcctgactatgtagtggtaggctta
gataattatctgacctatgaaaaagtagttaaagcaacacttgctattcaaaaaggtgct
actttcattggaacgaacccagataagaatatacctactgaacgcggccttcttcctgga
gcagggtcagtcatctcttttgtagagacagcaacccaaacgccgccgatctacatcgga
aaaccagaagccatcattatggataaagccgttgaagtattagggctgcaaaaagaagaa
gtaatcatggttggagataactatgaaacagatatccaagctgggatacgcaataatata
gatactttgctcgttttatcaggttttacaaaagaagaagatgtacctgggttgcctatc
ccagctacctatgtgaaacaatcactggatgaatggagcttctaa

DBGET integrated database retrieval system