KEGG   Enterococcus faecalis D32: EFD32_1176Help
Entry
EFD32_1176        CDS       T02172                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
efd  Enterococcus faecalis D32
Pathway
efd00071  Fatty acid degradation
efd00072  Synthesis and degradation of ketone bodies
efd00280  Valine, leucine and isoleucine degradation
efd00362  Benzoate degradation
efd00380  Tryptophan metabolism
efd00620  Pyruvate metabolism
efd00630  Glyoxylate and dicarboxylate metabolism
efd00640  Propanoate metabolism
efd00650  Butanoate metabolism
efd00900  Terpenoid backbone biosynthesis
efd01100  Metabolic pathways
efd01110  Biosynthesis of secondary metabolites
efd01120  Microbial metabolism in diverse environments
efd01130  Biosynthesis of antibiotics
efd01200  Carbon metabolism
efd01212  Fatty acid metabolism
efd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:efd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EFD32_1176
   00630 Glyoxylate and dicarboxylate metabolism
    EFD32_1176
   00640 Propanoate metabolism
    EFD32_1176
   00650 Butanoate metabolism
    EFD32_1176
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EFD32_1176
   00072 Synthesis and degradation of ketone bodies
    EFD32_1176
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EFD32_1176
   00310 Lysine degradation
    EFD32_1176
   00380 Tryptophan metabolism
    EFD32_1176
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EFD32_1176
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EFD32_1176
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EFD32_1176
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:efd04147]
    EFD32_1176
Enzymes [BR:efd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EFD32_1176
Exosome [BR:efd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EFD32_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF1134
Motif
Other DBs
NCBI-ProteinID: AFO44064
Position
1229196..1230386
Genome map
AA seq 396 aa AA seqDB search
MKTVVIIDALRTPIGKYKGSLSQVSAVDLGTHVTTQLLKRHSTISEEIDQVIFGNVLQAG
NGQNPARQIAINSGLSHEIPAMTVNEVCGSGMKAVILAKQLIQLGEAEVLIAGGIENMSQ
APKLQRFNYETESYDAPFSSMMYDGLTDAFSGQAMGLTAENVAEKYHVTREEQDQFSVHS
QLKAAQAQAEGIFADEIAPLEVSGTLVEKDEGIRPNSSVEKLGTLKTVFKEDGTVTAGNA
STINDGASALIIASQEYAEAHGLPYLAIIRDSVEVGIDPAYMGISPIKAIQKLLARNQLT
TEEIDLYEINEAFAATSIVVQRELALPEEKVNIYGGGISLGHAIGATGARLLTSLSYQLN
QKEKKYGVASLCIGGGLGLAMLLERPQQKKTADFIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacagtagttattattgatgcattacgaacaccaattggaaaatataaaggcagc
ttaagtcaagtaagtgccgtagacttaggaacacatgttacaacacaacttttaaaaaga
cattccactatttctgaagaaattgatcaagtaatctttggaaatgttttacaagctgga
aatggccaaaatcccgcacgacaaatagcaataaacagcggtttgtctcatgaaattccc
gcaatgacggttaatgaggtctgcggatcaggaatgaaggccgttattttggcgaaacaa
ttgattcaattaggagaagcggaagttttaattgctggtgggattgagaatatgtcccaa
gcacctaaattacaacgatttaattacgaaacagaaagctacgatgcgcctttttctagt
atgatgtacgatgggttaacggatgcctttagtggtcaggcaatgggcttaactgctgaa
aatgtggccgaaaagtatcatgtaactagagaagagcaagatcaattttctgtacattca
caattaaaagcagctcaagcacaagcagaagggatattcgctgacgaaatagccccatta
gaagtgtcaggaacgcttgtggagaaagatgaagggattcgccctaattcgagcgttgag
aagctaggaacgcttaaaacagtttttaaagaagacggtactgtaacagcagggaatgca
tcaaccattaatgatggggcttctgctttgattattgcttcacaagaatatgccgaagca
cacggtcttccttatttagctattattcgagacagtgtggaagtcggtattgatccagcc
tatatgggaatttcgccgattaaagccattcaaaaactgttagcgcggaatcaacttact
acggaagaaattgatctgtatgaaatcaacgaagcatttgcagcaacttcaatcgtggtc
caaagagaactggctttaccagaggaaaaggtcaacatttatggtggcggtatttcatta
ggtcatgcgattggtgccacaggtgctcgtttattaacgagtttaagttatcaattaaat
caaaaagaaaagaaatatggcgtggcttctttatgtatcggcggtggcttaggactcgct
atgctactagagagacctcagcaaaaaaaaacagccgattttatcaaatga

DBGET integrated database retrieval system