KEGG   Enterococcus faecalis D32: EFD32_2868Help
Entry
EFD32_2868        CDS       T02172                                 

Definition
(GenBank) Na+ transporting oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
efd  Enterococcus faecalis D32
Pathway
efd00620  Pyruvate metabolism
efd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EFD32_2868
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efd02000]
    EFD32_2868
Enzymes [BR:efd01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EFD32_2868
Transporters [BR:efd02000]
 Other transporters
  Primary active transporters [TC:3]
   EFD32_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like His_biosynth MPLKIP
Motif
Other DBs
NCBI-ProteinID: AFO45748
Position
complement(2966264..2967661)
Genome map
AA seq 465 aa AA seqDB search
MSKKIRFTETVLRDGQQSLIATRMPTSDMLPIIKTMDEAGFHALEMWGGATFDSCVRYLN
EDPWERLRQIRKEVKNTKLQMLLRGQNLLGYRHYADDVVRAFVEKSVENGIDIIRIFDAL
NDVRNLQTAIQTTKEAGGHCQAAISYTTSEIHTIDYFVKLAKELSQTGADSICIKDMAGV
LTPQTGFELVSKMKDAIDLPLEVHTHATSGISEMTYLKVAEAGADIIDTAISSFAGGTSQ
PATESVAIALEDLGFETGLNMEKVTEIADYFNPIRDRFRSEGILNPKVKDTEPKTLIYQV
PGGMLSNLLSQLTEQGLQDKYEEVLAEVPKVRADLGYPPLVTPLSQMVGTQALMNVISGE
RYSLIPNEIKDYVRGEYGKSPAPIAEEIKQKIIGDEEVITCRPADLLKPELHSLENEIQQ
YAKSEEDVLLYAMFPQQGKDFLGRREDPFYDVPLQKVTVKLDLPE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaaaaattcgttttacagaaacggtgctacgggatggacaacaaagtttaatt
gcaacacggatgccaacctcagatatgctgccgattattaaaacaatggacgaggcagga
tttcatgcattagaaatgtggggcggggcaacgtttgattcctgtgtccgctatttaaac
gaggatccttgggaacgtcttcgccaaattcgcaaagaagttaaaaataccaaacttcaa
atgttattacgaggacaaaatttactaggatatcgtcattacgctgatgatgtggtgcgg
gcctttgtcgaaaaatcagttgaaaatgggattgatattattcgtattttcgatgccttg
aatgatgtccgtaatttacaaacagcaattcaaacaacaaaagaagctggcggacactgt
caagcagcgatttcttataccacgagtgaaattcataccatcgattactttgtaaaatta
gccaaagaattaagtcaaacaggagcggattccatttgtattaaggatatggcaggcgtt
ttgacgccacaaactggttttgaattagtgagcaaaatgaaagatgccattgatttacct
ttagaggtgcatacgcatgcgactagtggtatttctgagatgacctatttaaaagttgct
gaagcaggtgcggatatcatcgatacagctatctcttctttcgctggcggtacgagtcaa
ccagccacagaatctgtagccattgcgttagaagatttaggctttgaaacaggtttaaat
atggaaaaagtaacagagattgctgactatttcaatccgattcgtgatcgctttagaagt
gaaggcattttaaaccctaaagttaaagatacggaaccgaaaaccttgatttatcaagtg
cctggtggtatgttatcaaacttattaagtcaattaacggagcaaggcttacaagacaaa
tatgaagaagttttagctgaagtacctaaagtaagagcagatttagggtacccaccacta
gttacgccgctttcacaaatggttggaacacaagccttaatgaatgtgatttctggggaa
agatattccttaataccgaatgaaatcaaagattatgtgcgcggagaatatggcaaatca
ccagcacctatcgcagaagagattaagcaaaaaatcattggggatgaagaggtaatcact
tgtcgaccagcggatttattgaaaccagagttgcatagtttagaaaatgaaatccaacaa
tatgcaaaatctgaagaggatgtcctattatatgcgatgttcccacaacaaggaaaagac
tttttaggacgtcgcgaagatcctttttacgatgtaccgttacagaaagtgacagtcaaa
cttgacttgccagaatag

DBGET integrated database retrieval system