KEGG   Escherichia fergusonii: EFER_0261Help
Entry
EFER_0261         CDS       T00811                                 

Gene name
ygdE
Definition
(GenBank) putative methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
efe  Escherichia fergusonii
Brite
KEGG Orthology (KO) [BR:efe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:efe03009]
    EFER_0261 (ygdE)
Enzymes [BR:efe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     EFER_0261 (ygdE)
Ribosome biogenesis [BR:efe03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EFER_0261 (ygdE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 MIT_C
Motif
Other DBs
NCBI-ProteinID: CAQ87830
UniProt: B7LVW4
Position
275415..276515
Genome map
AA seq 366 aa AA seqDB search
MNKVVLLCRPGFEKECAAEITDKAGRQEIFGFARVKENAGYVIYECYQAEDGDKLIRELP
FSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFC
RKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKF
PADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVD
NGPMAQSLMDTGQVTWLREDGFKFRPTRNNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgtattgttgtgtcgcccaggcttcgaaaaagagtgtgccgcagaaatc
acggacaaagcagggcgacaagagattttcggttttgctcgtgtgaaagagaatgcgggt
tatgtcatttatgaatgttatcaagctgaagatggcgataaattaattcgtgaattgcca
ttcagctcgttgatctttgcccgtcagtggtttgtggtgggcgagttgcttcagcattta
ccaccagaagatcgcattacccctatagtcggcatgttgcagggtgtggtggagaaaggc
ggtgagttgcgtgttgaagttgccgataccaacgaaagcaaagaactgctcaaattctgt
cgtaaattcacggtgccattacgtgcagcattgcgtgatgcaggtgtccttgcgaactat
gaaacgccgaagcgtccggtggtgcatgtgttctttattgcaccaggttgctgctatacc
ggttattcttacagcaataataattcaccgttctatatgggcattccgcgtctgaagttc
ccggcagatgcaccaagccgttccacgctcaaactggaagaggcatttcatgtatttatt
ccggcagatgagtgggatgaacgtctggcaaacggaatgtgggcagtggatctgggggct
tgccctggcggttggacttaccagttagtgaagcgcaacatgtgggtatattccgttgat
aacggcccgatggcgcaaagtttgatggataccggccaggtcacatggctacgggaagat
ggttttaaattccgtccgacgcgtaacaacatttcctggatggtgtgcgatatggttgag
aaacctgcaaaagtagctgcactgatggcgcaatggctggttaatggctggtgccgtgaa
accatcttcaaccttaaactgccaatgaaaaaacgctacgaagaagtgtcacataatctg
gcgtacattcaggctcagcttgatgaacatggcattaatgcccagattcaggcgcgacag
ttgtatcacgatcgcgaagaagtgacggtgcatgtccgtcgtatatgggctgctgttggt
ggtcgtcgcgacgaacgctaa

DBGET integrated database retrieval system