KEGG   Escherichia fergusonii: EFER_0822Help
Entry
EFER_0822         CDS       T00811                                 

Gene name
yfcY
Definition
(GenBank) beta-ketoacyl-CoA thiolase, anaerobic, subunit
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
efe  Escherichia fergusonii
Pathway
efe00071  Fatty acid degradation
efe00280  Valine, leucine and isoleucine degradation
efe00281  Geraniol degradation
efe00362  Benzoate degradation
efe00592  alpha-Linolenic acid metabolism
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
efe01130  Biosynthesis of antibiotics
efe01212  Fatty acid metabolism
Module
efe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:efe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EFER_0822 (yfcY)
   00592 alpha-Linolenic acid metabolism
    EFER_0822 (yfcY)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EFER_0822 (yfcY)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    EFER_0822 (yfcY)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EFER_0822 (yfcY)
   00642 Ethylbenzene degradation
    EFER_0822 (yfcY)
Enzymes [BR:efe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     EFER_0822 (yfcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAQ88358
UniProt: B7LLC9
Position
837734..839044
Genome map
AA seq 436 aa AA seqDB search
MGQVLPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVVSELLARSEIPPAAIE
QLVFGQVVQMPEAPNIAREIVLGTGMSVHTDAYSVSRACATSFQAVANVAESLMAGTIRA
GIAGGADSSSVLPIGVSKKLARVLVDVNKARTLGQRLKLFSRLRLHDLLPVPPAVAEYST
GLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWSEGKLTNEVMTAYVPPYKAPLSE
DNNIRGNSTLADYARLRPAFDRKHGTVTAANSTPLTDGAAAVIMMTESRAKELGLTPLGY
LRSYAFTAIDVWQDMLLGPAWSTPLALDRAGLTLADLTLIDMHEAFAAQTLANVQLLGSE
RFARDVLGRAHATGEVDDSKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT
ACAAGGLGAAMVLEAE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggttttaccgctggtcacccgccagggcgatcgtatcgccattgttagtgga
ttacgtacgccattcgcgcgtcaggcgacagcttttcatggcattcccgctgttgatctg
ggaaaaatggtggtaagtgaactacttgctcgtagtgaaattcctcctgctgcgattgaa
caactggtgtttggtcaggtggtacaaatgccggaagcccccaacatcgcacgtgaaatt
gtgttgggcacagggatgagtgttcataccgatgcatacagcgtcagccgcgcttgcgcg
accagcttccaggcggtggcaaatgttgctgaaagcctgatggcaggaaccatacgtgca
ggtatcgccggaggagctgactcttcttcagtattgcctattggcgtcagcaagaagctg
gcgcgggtattagttgatgttaataaagccagaacgctgggccagcggctgaaattattt
tctcgtctgcgtcttcacgacttattgcctgtaccgcctgcggttgccgaatactccact
ggcttacgtatgggcgataccgctgagcaaatggcaaaaacttatggcattacccgtgaa
cagcaggatgcattggcacatcgttcgcatcaacgagcagctcaagcgtggagcgaaggc
aaactgacgaatgaggtgatgacagcttatgttccgccttataaagcgccattgagtgaa
gataacaatattcgtggtaattccacacttgccgattatgcccgcttgcgcccggcattt
gaccgtaagcatggcacggtaaccgcagcgaacagtacgccactgacggatggcgcagct
gcagtcattatgatgacagaaagccgggcaaaagaacttggactaacaccgttgggatat
ttacgcagctatgcttttacagccattgatgtctggcaggacatgttgctcggcccggca
tggtcgacaccactggcactggatcgtgcaggactgacactggcagatcttacactgatt
gatatgcatgaagcctttgcagcgcagacgttggccaatgttcagttgctcggtagtgaa
cgtttcgcccgcgatgtgttggggcgcgctcatgcgacaggagaggtcgatgacagtaaa
tttaatgtgctggggggctccatcgcttatggtcatccttttgccgctaccggcgcacga
atgattacccaaacgctccatgaacttcgtcgtcgaggcggcggtttcgggttggtgaca
gcctgtgctgctggtggtttaggtgcagcaatggttctggaggcggaataa

DBGET integrated database retrieval system