KEGG   Escherichia fergusonii: EFER_1093
Entry
EFER_1093         CDS       T00811                                 

Gene name
ycbG
Definition
(GenBank) conserved hypothetical protein
  KO
K09911  uncharacterized protein
Organism
efe  Escherichia fergusonii
Brite
KEGG Orthology (KO) [BR:efe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    EFER_1093 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: CAQ88622
UniProt: B7LNW6
Position
1138611..1139066
AA seq 151 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDLLLTLENEPVKVNDWIAK
HMNPALVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFMVWQRLAGLAHRRGKTLSETIV
QLIEDAEHKEKYANTMSSLKQDLQALLGKND
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatctcgaaagcggttggaagtggaaatacctggtgaaa
aagcatcgtgaaggggagttgatcacccgttacattgaggccagtgctgcccaggaagcc
gtggatctactactgacgctggaaaatgagccagtgaaagtgaatgactggattgcaaaa
cacatgaatccggcattagttaatcgtatgaagcagacgattcgcgccagacgtaagcgc
cattttaatgcggagcatcagcatacgcggaagaaatctatcgaccttgaatttatggtc
tggcagcgactggcggggcttgcgcatcggcgtggtaaaacactgtcggaaacaattgtg
caattaatcgaagacgccgagcataaagagaagtacgccaatactatgtcgtcgttgaaa
caggatttacaggccctgctaggaaaaaatgattag

DBGET integrated database retrieval system