KEGG   Escherichia fergusonii: EFER_1345Help
Entry
EFER_1345         CDS       T00811                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
efe  Escherichia fergusonii
Pathway
efe00010  Glycolysis / Gluconeogenesis
efe00030  Pentose phosphate pathway
efe00051  Fructose and mannose metabolism
efe00052  Galactose metabolism
efe00680  Methane metabolism
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
efe01130  Biosynthesis of antibiotics
efe01200  Carbon metabolism
efe01230  Biosynthesis of amino acids
Module
efe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_1345 (pfkB)
   00030 Pentose phosphate pathway
    EFER_1345 (pfkB)
   00051 Fructose and mannose metabolism
    EFER_1345 (pfkB)
   00052 Galactose metabolism
    EFER_1345 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    EFER_1345 (pfkB)
Enzymes [BR:efe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EFER_1345 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: CAQ88866
UniProt: B7LQ69
Position
complement(1379001..1379933)
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSSPVFEPGGGGINVARAIAHLSGSATAIFP
AGGATGEHLVALLADENVPVATIETKDWTRQNLHVHVESSGEQYRFVMPGATLSEDEFRQ
LEEQVFEIESGAILVISGSLPPGVELKKLTQLISAAQKQGIRCIIDSSGEALAAALAIGH
IELVKPNLKELSALVNRELLQPDDVRKAAQEIVDCGKAHRVVVSLGPQGALAVDKESCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAEGASLEDMVRFGVAAGSAATLNQGTRLCSADDT
HKIYAWLTRQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctacacgttaacacttgcgccctcactcgacagcgcgacaattaccccg
cagatttatcccgaaggcaaactacgctgttcttctcccgtttttgaacctggtggtggc
ggaatcaacgtcgcccgagctattgctcatcttagcggcagcgcgacagcgatattcccg
gcaggcggtgctacgggggagcatctggtcgccctgcttgccgatgaaaacgtcccggtc
gccaccatcgaaacgaaagactggacccgacaaaatctgcatgtccatgtagaatccagt
ggcgaacagtatcgtttcgtgatgcctggggccacgctcagtgaagatgagtttcgtcag
ctcgaagagcaagtctttgaaatagaatctggtgccattctggtcataagcggcagcctg
ccaccaggagtagaactgaaaaagttaacgcaacttatttctgccgcacaaaagcaaggg
attcgttgcattattgatagctctggcgaagcactcgcagctgcgctggcaattggtcat
atagagttagtaaaaccgaatctcaaagaattgagtgccctggttaatcgtgagctttta
caacccgatgacgtccgcaaagcagctcaggagattgtcgactgtggtaaagcccatcgt
gtagtggtgtcgcttggtccacaaggtgccctggcagtagacaaggagtcatgcattcag
gtcgttcctcctccggtaaaaagtcagagtacagtgggtgcaggtgacagcatggtgggc
gcaatgacactgaagcttgcagaaggagcctctctggaagatatggttcgatttggtgta
gctgccgggagtgccgcaacactcaatcagggaacacgtctatgttctgctgacgacact
cacaaaatctatgcctggcttaccaggcaataa

DBGET integrated database retrieval system