KEGG   Escherichia fergusonii: EFER_1714Help
Entry
EFER_1714         CDS       T00811                                 

Gene name
adhE
Definition
(GenBank) fused acetaldehyde-CoA dehydrogenase; iron-dependent alcohol dehydrogenase; pyruvate-formate lyase deactivase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efe  Escherichia fergusonii
Pathway
efe00010  Glycolysis / Gluconeogenesis
efe00071  Fatty acid degradation
efe00350  Tyrosine metabolism
efe00620  Pyruvate metabolism
efe00625  Chloroalkane and chloroalkene degradation
efe00626  Naphthalene degradation
efe00650  Butanoate metabolism
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
efe01130  Biosynthesis of antibiotics
efe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_1714 (adhE)
   00620 Pyruvate metabolism
    EFER_1714 (adhE)
   00650 Butanoate metabolism
    EFER_1714 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    EFER_1714 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EFER_1714 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EFER_1714 (adhE)
   00626 Naphthalene degradation
    EFER_1714 (adhE)
Enzymes [BR:efe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EFER_1714 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EFER_1714 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: CAQ89230
UniProt: B7LS38
Position
1761556..1764231
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFATHGGYILQGKELKAVQDVILKNGALNAAIVGQP
AYKIAELAGFTVPQNTKILIGEVTAVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPARVTYFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYNEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDFVEGAAVNQEAAPAPKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaggcccag
cgtgaatatgccagtttcactcaagagcaagtagacaaaatcttccgtgccgccgccctg
gctgccgcagatgctcgaatccctctcgctaaaatggccgttgccgaatccggcatgggt
atcgttgaagataaagtgattaaaaaccacttcgcttctgaatacatctataacgcgtat
aaagatgaaaagacctgtggtgttctttctgaagatgacacctttggtactatcactatc
gcagaaccaatcggcattatctgtggtattgttccgaccactaacccaacctccacggct
atcttcaaatcgctgatcagcctgaagactcgtaacgccattatcttctctccacatccg
cgcgcaaaagatgcaaccaacaaagctgcagatatcgttctgcaggctgctatcgctgct
ggtgcgccgaaagacctgattggctggatcgatcaaccttctgttgaactctccaacgcg
ctgatgcaccacccggatatcaacctgatccttgcaactggtggcccaggcatggttaag
gcggcgtatagctccggtaaacctgcaatcggtgtaggtgcaggtaacacccctgttgtt
attgacgaaactgcagatatcaaacgagctgttgcttctgtactgatgtctaaaaccttc
gataacggcgttatttgtgcttccgagcagtcagttgttgttgttgattctgtctatgat
gccgttcgtgaacgtttcgcaactcatggcggttatatcttacagggcaaagaactgaaa
gctgttcaggatgtcatcctgaaaaacggtgctctgaacgcagcaatcgttggtcagccg
gcatataaaattgctgagctggcaggtttcaccgttccgcaaaacacgaagattctgatc
ggtgaagtaactgctgttgacgaaagcgaaccgtttgcacacgagaagctgtcccctact
ctggctatgtatcgtgcgaaagatttcgaagatgcagtagaaaaagcagagaaactggta
gcgatgggcggtatcggtcatacctcctgcctgtacaccgatcaggacaaccaaccggca
cgcgtgacctacttcggtcagaaaatgaaaactgcccgtatcctgatcaacaccccggct
tctcagggtggtatcggtgacctgtacaactttaaactcgcgccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcataaacttccgaaatcgatc
tacttccgtcgtggctctctgccaatcgcactggatgaagtgattactgatggtcacaaa
cgtgctctgatcgttaccgaccgcttcctgttcaacaatggttatgcagatcagatcacc
tctgtgctgaaagccgctggtgttgaaactgaagtgttctttgaagtagaagctgatcct
accctgagcgtggtacgtaaaggtgctgagctggcaaactccttcaaaccagacgttatt
atcgcgctgggtggtggttccccgatggatgccgcgaaaatcatgtgggtaatgtacgaa
catccggaaactcacttcgaagaactggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgctgttactactacttccggt
actggttctgaagtaactccgtttgcggttgtaaccgatgatgcaactggtcagaaatat
ccgctggcagactacgcactgactccggatatggcgattgttgatgctaacctggttatg
gacatgccgaagtctctgtgtgcctttggtggtctggatgcagtaacccacgctctggaa
gcttacgtttctgtactggcttctgagttctctgacggtcaggctctgcaggcactgaaa
ctgctgaaagaaaacctgccagcgtcttacaacgaaggttctaaaaacccggttgctcgt
gaacgcgttcacagtgctgcaacgattgccggtatcgcgtttgcgaacgccttcctgggt
gtatgtcactctatggcgcataaactgggttctcagttccacattccgcatggtctggcg
aacgccctgctgatctgtaacgttattcgttacaacgcgaacgacaacccgaccaagcag
actgcatttagccagtatgaccgtccgcaggcacgccgtcgttacgctgaaatagcagat
catctgggtctgagcgcaccgggtgaccgtactgcagcgaagattgagaaactgttagca
tggctggaaagtctgaaagctgaactgggtattccaaaatctatccgtgaagctggcgtt
caggaagcagacttcctggcgaacgtagataaactgtctgaagatgcattcgatgatcag
tgcaccggcgctaacccgcgttaccctctgatctctgaactgaagcagattctgctggat
acttactacggtcgtgattttgttgaaggtgctgcagtcaatcaagaagctgccccggcg
ccaaaagcagagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system