KEGG   Escherichia fergusonii: EFER_3610Help
Entry
EFER_3610         CDS       T00811                                 

Gene name
hemN
Definition
(GenBank) coproporphyrinogen III oxidase, SAM and NAD(P)H dependent, oxygen-independent
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
efe  Escherichia fergusonii
Pathway
efe00860  Porphyrin and chlorophyll metabolism
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
Module
efe_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:efe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EFER_3610 (hemN)
Enzymes [BR:efe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     EFER_3610 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: CAQ91082
UniProt: B7LTM3
Position
complement(3699666..3701039)
Genome map
AA seq 457 aa AA seqDB search
MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFTRRKVSQLHWGGGTPTYLNK
AQISRLMKLLRENFQFNTDAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVF
NYAHLPTIFAAQRKIKDADLPSPQQKLDILQETIAFLTQSGYQFIGMDHFARPDDELAVA
QREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDCYAQNQKELKQYYQQVDEQGNALWRG
IALTRDDCIRRDVIKSLICNFRLDYAPIEQQWDLHFADYFAEDLKLLAPLAKDGLVDVDE
KGIQVTAKGRLLIRNICMCFDTYLRQKARMQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacagcaaatcgactgggatctggccctgatccagaaatataactattccggg
ccacgatacacctcgtacccgaccgcgctggagttttcagaagacttcggcgaacaggcg
tttttacaagccgtggcgcgctatcctgagcgtccattatctctctacgtacatatcccg
ttctgccacaaactttgttacttctgcggttgcaataagattgttactcgccagcagcac
aaggccgatcagtatctggacgcactagagcaagaaatcgtccatcgtgcgccgctgttt
accaggcgcaaggtgagccagctgcactggggcggtggaacgccgacatatctgaacaaa
gcgcaaatcagccgactgatgaagttgctgcgcgaaaacttccagttcaatactgatgcg
gagatttcgatcgaagtcgatccgcgcgaaatagaactggatgtactcgatcatttacgc
gccgaaggctttaatcgcctgagcatgggcgtgcaggacttcaacaaagaagtgcaacgt
ctggttaaccgcgagcaggatgaagagttcatctttgcactgcttaaccatgcgcgtgag
attggttttacttccaccaacatcgacctgatttacggcctgccgaagcagacgccggag
agtttcgcttttaccctgaaacgtgtggcggaacttaaccccgatcgtctgagtgtcttt
aactacgcgcatctgccgaccatttttgctgctcagcgcaaaatcaaagatgctgacctg
ccgagtccgcagcaaaaactcgatatcctgcaggaaaccatcgccttcctgacgcaatcg
ggctatcagtttatcgggatggatcactttgctcgcccggatgacgagctggcggtggcc
cagcgtgaaggcgtgctgcatcgtaacttccagggctacaccactcagggcgataccgat
ctgctggggatgggcgtttcagccatcagcatgattggcgactgctacgcgcagaaccag
aaagagttgaagcagtactatcagcaagtggatgaacaaggcaatgcgctgtggcgtggt
attgcgctaacgcgtgatgactgtattcgccgcgatgtgattaagtcgctcatctgcaac
ttccgtctggattacgcccctattgagcaacagtgggatttgcacttcgctgattacttt
gcggaagatctcaaactacttgccccgttagcaaaagatgggctggtggatgtggatgag
aaggggattcaggtgacggcgaaaggtcgcttgctgatccgcaacatttgcatgtgcttt
gatacctatctgcgtcagaaagcgcggatgcagcagttctcacgggtgatttaa

DBGET integrated database retrieval system