KEGG   Escherichia fergusonii: EFER_3867Help
Entry
EFER_3867         CDS       T00811                                 

Gene name
rhaB
Definition
(GenBank) rhamnulokinase
  KO
K00848  rhamnulokinase [EC:2.7.1.5]
Organism
efe  Escherichia fergusonii
Pathway
efe00040  Pentose and glucuronate interconversions
efe00051  Fructose and mannose metabolism
efe01100  Metabolic pathways
efe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:efe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EFER_3867 (rhaB)
   00051 Fructose and mannose metabolism
    EFER_3867 (rhaB)
Enzymes [BR:efe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.5  rhamnulokinase
     EFER_3867 (rhaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-ProteinID: CAQ91302
UniProt: B7LVD9
Position
3960870..3962339
Genome map
AA seq 489 aa AA seqDB search
MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWDVDSLESAI
RLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTHGLMALAQKQLGK
SDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWEYTNAT
TTQLVNINSDDWDETLLAWSGANKAWFGRPTHPGNVIGHWICPQGNEIPVVAVASHDTAS
AVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGRYRVLKNIMGL
WLLQRVLQERQINDLPALIAATQALPACRFIINPNDDRFINPDEMCSEIQAVCRETAQPI
PESDAELGRCIFDSLALLYADVLHELAQLRGEDFSQLHIVGGGCQNTLLNQLCADACGIR
VIAGPVEASTLGNIGIQLMALDELNNVDDFRQVVSTTANLTTFTPNPDSEIAHYVAQIHS
TRQTKELCA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcgcaattgtgtcgccgtcgatctcggcgcatccagtgggcgcgtgatgctg
gcgcgttacgagcgtgaatgccgcagcctgacgctgcgcgaaatccatcgttttaacaat
ggcctgcatagccagaacggttatgtcacctgggatgtggatagcctggaaagtgccatt
cgccttggattaaacaaggtgtgcgaggaagggattcgtatcgatagcattgggattgat
acctggggcgtggactttgtgctgctcgaccaacagggtcagcgtgtgggcctgcccgtt
gcttatcgcgatagccgcacccatggtctgatggcgctggcacaaaagcaactcggtaaa
agcgatatttatcagcgtagcggcatccagtttttgcccttcaatacgctctatcagctg
cgtgcgctgacggagcaacaacctgaacttattccacacattgctcacgctctgctgatg
ccggattactttagttatcggctgaccggcaagatgaactgggagtataccaacgccacc
accacgcaactggtcaatatcaacagcgacgactgggacgaaacgctactggcgtggagc
ggggccaacaaagcctggtttggtcgcccgacgcatccgggtaatgtcattggtcactgg
atttgcccgcaaggtaatgagattcctgtcgtcgccgttgccagccatgacaccgccagc
gcggttatcgcctcgccgttaaatggttcacgcgccgcttatctctcttctggcacctgg
tcattgatgggcttcgaaagccagacgccatttaccaatgacacggcgctggcagccaac
atcaccaatgaaggtggggcggaaggtcgctatcgggtgctgaaaaatatcatgggctta
tggctgcttcagcgggtgcttcaggagcggcaaatcaacgatcttccggcgcttatcgcc
gcgacacaggcactcccggcctgccgttttatcatcaatcccaatgacgatcgctttatt
aatcctgacgagatgtgcagcgaaattcaggctgtgtgtcgggaaacggcgcaaccaatc
ccggaaagtgatgctgaactgggacgctgtattttcgacagtctggcgctgctgtatgcc
gatgtgttgcatgagctggcgcagttgcgcggtgaagatttctcgcaactgcatattgtc
ggcggcggctgccagaacacgctgctcaatcagttatgtgccgatgcctgcggtattcgg
gtgattgccgggcctgttgaagcctcgacgctcggcaatatcggcatccagttaatggcg
ctggatgaactcaacaatgtggatgatttccgtcaggtcgtcagcaccaccgcgaatctg
accacctttacccctaatcctgacagtgaaattgcccactatgtggcgcagattcactct
acacgacagacaaaggagctttgcgcatga

DBGET integrated database retrieval system