KEGG   Escherichia fergusonii: EFER_4081Help
Entry
EFER_4081         CDS       T00811                                 

Definition
(GenBank) sorbose-specific phosphotransferase enzyme IIA component (PTS system)
  KO
K02812  PTS system, sorbose-specific IIA component [EC:2.7.1.206]
Organism
efe  Escherichia fergusonii
Pathway
efe00051  Fructose and mannose metabolism
efe01100  Metabolic pathways
efe02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:efe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EFER_4081
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    EFER_4081
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efe02000]
    EFER_4081
Enzymes [BR:efe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     EFER_4081
Transporters [BR:efe02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    EFER_4081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man SHMT
Motif
Other DBs
NCBI-ProteinID: CAQ91504
UniProt: B7LKW3
Position
complement(4186162..4186569)
Genome map
AA seq 135 aa AA seqDB search
MVNAIFCAHGKLACAMLESVQMVYGDANVVAVEFVPGENASDIINKLEKLVSIHAHDEWL
IAVDLQCGSPWNAAATLAMQNPHLRVMSGLSLPLALELVDNQSSMNVDELCVHLTQVASQ
TCVIWQQPDTTDEEF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggttaatgcaatcttctgtgcccatggcaaattagcttgcgccatgctggagtcggta
cagatggtgtacggcgacgccaatgttgtagccgtagaatttgtacctggagaaaatgcc
agcgacatcataaataagctggaaaagttagtaagcattcacgctcatgatgaatggctg
attgccgtggacttacagtgcggtagtccatggaatgccgctgccacactggcaatgcaa
aacccacatctgcgtgtcatgagcgggttatcgctccctctggcgctggaactggtggac
aaccagagcagtatgaatgtcgatgaactgtgtgtacacctgacgcaagtcgcctcacaa
acttgtgttatctggcaacaaccggatacgactgacgaggagttctga

DBGET integrated database retrieval system