KEGG   Escherichia fergusonii: EFER_4226Help
Entry
EFER_4226         CDS       T00811                                 

Gene name
hflX
Definition
(GenBank) putative GTPase
  KO
K03665  GTPase
Organism
efe  Escherichia fergusonii
Brite
KEGG Orthology (KO) [BR:efe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:efe03009]
    EFER_4226 (hflX)
Ribosome biogenesis [BR:efe03009]
 Prokaryotic Type
  GTPases
   EFER_4226 (hflX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP-bdg_N GTP-bdg_M MMR_HSR1 FeoB_N RsgA_GTPase Arf GTP_EFTU MMR_HSR1_Xtn Dynamin_N ATP_bind_1 cobW TniB SRPRB Ras ABC_tran MnmE_helical DUF4011
Motif
Other DBs
NCBI-ProteinID: CAQ91645
UniProt: B7LLV5
Position
4334004..4335284
Genome map
AA seq 426 aa AA seqDB search
MFDRYDAGEQAVLVHIYFTQDKDMEDLQEFESLVSSAGVEALQVITGSRKAPHPKYFVGE
GKAVEIAEAVKATGASVVLFDHALSPAQERNLERLCECRVIDRTGLILDIFAQRARTHEG
KLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETDRRLLRNRIVQIQSRLER
VEKQREQGRQSRIKADVPTVSLVGYTNAGKSTLFNRITEARVYAADQLFATLDPTLRRID
VADVGETVLADTVGFIRHLPHDLVAAFKATLQETRQATLLLHVIDAADVRVQENIEAVNT
VLEEIDAHEIPTLLVMNKIDMLEDFEPRIDRDEENKPIRVWLSAQTGAGIPQLFQALTER
LSGEVAQHTLRLPPQEGRLRSRFYQLQAIEKEWMEEDGSVSLQVRMPIVDWRRLCKQEPA
LIDYLI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaccgttatgatgctggtgagcaggcggtactggtacacatctattttacgcaa
gacaaagatatggaagacctccaggagtttgaatctctggtttcttccgccggtgtcgaa
gcattgcaggtgattaccggtagccgtaaagcgccgcacccaaagtattttgtaggtgaa
ggtaaagcagttgaaattgcggaagctgtcaaagcgacgggtgcttcggtcgttcttttt
gaccatgccctgagcccggcgcaagagcgtaacctggagcgtttgtgcgagtgtcgtgtt
atcgaccgcaccggccttattttagatattttcgcccaacgtgcgcgtacccatgagggt
aagttgcaggttgagctggcgcagttgcgccatctggctacgcgcctggtgcgtggctgg
acccaccttgaaagacagaaaggcgggatcggtttgcgtggtccgggtgaaacccagctc
gaaaccgaccgtcgtttgttgcgtaatcgcatcgtgcagatacagtcgcgcctggaaaga
gttgaaaaacagcgtgagcaggggcggcaatcgcgtatcaaagccgacgttcctactgtt
tcgctggtgggatataccaacgccggtaaatctacccttttcaatcgcatcaccgaagcg
cgggtctatgcggcagaccagttgtttgccaccctcgacccgacgttgcggcgtattgac
gtcgcggatgtcggtgaaaccgtgttggcagataccgtagggtttattcgccacctgccg
cacgatctggtggcggcatttaaagccacgttacaagagacgcggcaagccacattgctg
ctgcacgtcattgacgcggcagatgtgcgagtacaagaaaacatcgaagcggtgaatacg
gttcttgaagagatcgatgctcacgagatcccaaccctgctggtgatgaacaagatcgat
atgctggaagattttgaaccgcgtattgatcgggacgaagagaacaaaccgatccgtgtc
tggctttctgcgcagaccggagcggggataccacagctttttcaggctttgacggagcgt
ctttccggcgaggtggcgcagcatacattgcgtctgccgccgcaggaagggcgtctgaga
agtcgtttttatcagcttcaggcaatagaaaaagagtggatggaggaggacggcagcgta
agtctgcaagttcgtatgccgatcgttgactggcgtcgcctctgcaaacaagaaccggcg
ttgatcgattacttgatctaa

DBGET integrated database retrieval system