KEGG   Enterococcus faecalis OG1RF: OG1RF_11644Help
Entry
OG1RF_11644       CDS       T01882                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
efi00430  Taurine and hypotaurine metabolism
efi00620  Pyruvate metabolism
efi00640  Propanoate metabolism
efi00680  Methane metabolism
efi01100  Metabolic pathways
efi01120  Microbial metabolism in diverse environments
efi01200  Carbon metabolism
Module
efi_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:efi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OG1RF_11644 (ackA)
   00640 Propanoate metabolism
    OG1RF_11644 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    OG1RF_11644 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    OG1RF_11644 (ackA)
Enzymes [BR:efi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     OG1RF_11644 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AEA94331
Position
complement(1713106..1714293)
Genome map
AA seq 395 aa AA seqDB search
MSKTIAINAGSSSLKWQLYQMPNEEVIAKGIVERIGLKDSIFTIKYGEGQKYEVIVDIDN
HEVAVKMLLDQLIDLNILGSYDEITGVGHRVVAGGEEFKDSVVITDEVLEKIEALSELAP
LHNPANAMGIKAFKHILPEIISVAVFDTSFHTTMPEHNYLYSVPREYYEKFAARKYGAHG
TSHRYVSQRAAEMLGRPIEDLKIITCHLGNGASITAVDGGKSVDTSMGFTPLAGVTMGTR
SGDVDASLLPYLMTKLGLTDVQDMVDILNKKSGLLGLTNGLSSDMRDIQSNLDKPEVQTA
YNIFIDRIRKYIGSYVTVMNGVDAIVFTAGIGENAVGVRKDIIDGMTWFGCEIDDDKNNV
HGEEAVISTDDSKIKLLLVPTDEELMIARDVERLK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaacaattgcaattaatgcaggtagttcaagtttaaaatggcaattataccaa
atgccaaatgaagaagtgatcgctaaaggaatcgttgaacgtattggcttaaaagattct
atcttcacaattaaatatggtgaaggacaaaaatatgaagtaattgttgatattgataac
catgaagtggcagtaaaaatgttactagaccaattaatcgacttaaacattttaggttct
tatgatgaaattactggtgttggtcaccgtgtagttgctggtggagaagaatttaaagat
tctgttgttattacagacgaagtattagaaaaaattgaagctttatctgaattagcacct
ttacacaacccagcgaatgcgatggggattaaagcatttaaacatatcttaccagaaatc
attagcgtggcagtctttgatacgtcgttccacacaacaatgccagaacacaactattta
tatagtgtaccgcgtgaatactatgaaaaatttgctgcacgtaaatatggggcacatgga
acaagtcatcgttatgtctctcaacgtgctgcagaaatgttaggtcgtccaattgaagac
ttgaaaattatcacttgtcacttaggaaatggtgcttcaatcactgcagttgatggtggt
aaatcagtcgatacatcaatgggcttcactcctcttgctggcgttacaatggggactcgt
tcaggggatgttgatgcgtcactattgccttatttaatgacaaaacttggcttgactgat
gtacaagacatggttgatattttaaacaaaaaatctggtttattaggtttaacaaatggt
ttatcaagcgacatgcgtgatattcaatcaaacttagataaacctgaagttcaaacagca
tacaacatttttatcgatcgtattcgtaaatacattggtagctatgtcactgttatgaat
ggcgttgatgcgattgtctttactgctggaatcggtgaaaatgcagttggcgttcgtaaa
gatattattgatggcatgacttggtttggttgtgaaatcgatgatgacaaaaataatgta
cacggtgaagaagcagttatctcaactgatgattcaaaaatcaagcttctattagtacca
actgatgaagagttaatgattgcccgtgacgtagaacgtctaaaataa

DBGET integrated database retrieval system