KEGG   Candidatus Endolissoclinum faulkneri L5: P856_503Help
Entry
P856_503          CDS       T04221                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
efk  Candidatus Endolissoclinum faulkneri L5
Pathway
efk00564  Glycerophospholipid metabolism
efk01100  Metabolic pathways
efk01110  Biosynthesis of secondary metabolites
Module
efk_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:efk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    P856_503 (psd)
Enzymes [BR:efk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     P856_503 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AHC73720
UniProt: V9TWP3
Position
838475..839161
Genome map
AA seq 228 aa AA seqDB search
MLNLIIAPIAREGLPFIAIFALATIILSIITNWLFLPSLILTMGCVYFFRDPDRITPVRH
GLIISPADGVVISISQASWPEELGLNPGKVQRICIFMNVFDVHVNRIPVDCRIVKLTYIP
GKFINASLDKTSKQNERQLITMETQNGQLIALAQIAGLLARRIRCKVSEGQTMLAGERFG
MICFGSRVDIYLPPDVAPLIALGQRCIAGETVIADLDSTEALREGAMR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacttaattatagcaccgatcgctcgagaaggattgccatttatagcaattttt
gctctagcaacaattattttatccataataactaattggctatttttacctagtttaata
ttgacaatgggatgcgtgtactttttccgtgacccagataggataacgccggtgcgtcat
ggtctaattatcagtcccgctgacggtgtcgttatttcaattagccaagcctcatggcca
gaggaacttggccttaatccagggaaagtgcagcggatctgcattttcatgaatgttttc
gacgttcacgtaaatcgcatccctgttgattgccgaatcgttaaactcacttatattcct
ggtaaatttattaatgcttcgcttgacaaaacgagcaagcaaaatgaacgacaacttata
acaatggaaactcaaaacggccagctaattgctttagcacaaatcgctggactattggct
cgtcgcatacgatgcaaagttagcgaaggccaaaccatgctggcaggcgaacgttttggc
atgatatgctttggcagccgagtggacatttacctacctcctgatgttgcaccgttaata
gcacttggccagcgttgtatcgctggtgaaacagtgatcgctgatcttgatagcacggag
gcgctacgggaaggggcgatgcgatga

DBGET integrated database retrieval system