KEGG   Enterococcus faecalis 62: EF62_0249Help
Entry
EF62_0249         CDS       T01881                                 

Definition
(GenBank) peptidase, ArgE/DapE family protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00300  Lysine biosynthesis
efl01100  Metabolic pathways
efl01120  Microbial metabolism in diverse environments
efl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EF62_0249
Enzymes [BR:efl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     EF62_0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ADX78546
Position
complement(264187..265323)
Genome map
AA seq 378 aa AA seqDB search
MEKSEKISILQDVVKIKSVNGNEEEVAIYLQNLLKKYEIPSELVSYAPNRSSLVAYLGEN
REKVLGFSGHMDVVSEGDESQWTFPPFAAHIEGNKLYGRGATDMKSGLVAMVLAMIELKE
KEVPLNGAVKFLGTVGEEVGELGAGQLTEKGYADDLSALVIGEPTNYNLMYAHMGSINYS
VVSHGKEAHSSMPEEGINAINNLNEFITEANQQMAEVTANYENPELGRTIHNVTVIKGGT
QVNSIPGQAALQGNIRSIPEFSNDQVIALLQKIVDELNKKEKHQLELTIDYNKIPVKAEK
DSALIQAIQAQFDQPLPLVTSAGTTDLAEFTKSDNTFDCVVFGPGVTTTAHQVDEYVEID
NYLDMIDKYQAIAKSYLN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcagaaaaaattagtattttacaagatgtggttaaaattaaatctgtaaat
ggaaacgaagaagaagtggcaatctatttacaaaatcttttgaagaaatatgagatccct
tctgaacttgtttcttatgcaccaaatcgtagtagtttggttgcttatttaggtgaaaac
cgagaaaaagtcttagggtttagtggccacatggacgtggtttctgaaggggacgaaagt
caatggactttcccaccatttgcggcccatattgaaggaaataaattgtatggccgtggc
gcaacggacatgaaaagcggcttagtcgcaatggttttagcaatgattgaattaaaagaa
aaggaagttccattaaatggagcggttaaatttttaggtacagttggtgaagaagtcggt
gagctaggtgctggccaattaactgaaaaaggctatgcggatgatttaagtgccttagtc
attggagaaccaaccaattataacttgatgtatgcgcacatgggttcaattaactattct
gttgtgtcacacggaaaagaagcccacagttcgatgccagaagaaggcattaacgcgatt
aataatttgaacgaatttattacagaagcaaaccaacaaatggcggaagtcacagcaaac
tatgaaaatcctgaattaggtcgaacgattcacaatgtaaccgtcattaaaggtggcaca
caagtgaacagtattccaggtcaagcagccttgcaagggaatatccgttcaattccagaa
ttcagcaacgatcaagtcattgcattattacaaaaaattgtcgatgaattgaacaaaaaa
gaaaaacatcagttagaattaacgattgattacaataaaattcctgtaaaagctgagaaa
gattctgcgttaattcaagccattcaagcccaatttgatcaaccattaccattagtgaca
agcgctgggaccacagacttagctgaatttactaaatcagacaatacatttgattgcgtt
gtctttggaccaggtgtgaccactactgcacaccaagtcgacgaatatgtcgaaattgat
aattatttagatatgattgataagtatcaagcgatagcaaaaagttatttaaattaa

DBGET integrated database retrieval system