KEGG   Enterococcus faecalis 62: EF62_0698Help
Entry
EF62_0698         CDS       T01881                                 

Definition
(GenBank) acyl-ACP thioesterase family protein
  KO
K01071  medium-chain acyl-[acyl-carrier-protein] hydrolase [EC:3.1.2.21]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00061  Fatty acid biosynthesis
efl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EF62_0698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:efl01004]
    EF62_0698
Enzymes [BR:efl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     EF62_0698
Lipid biosynthesis proteins [BR:efl01004]
 Fatty acid synthase
  Component type
   EF62_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-ACP_TE 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ADX78961
Position
714781..715515
Genome map
AA seq 244 aa AA seqDB search
MGKKHTSSYEVAYYDGDFTGAMKIPALLAVVIKVSEEQTELLGRDAAYVAQFGLGWVITN
YEIEIHRLPKVGEKVAITTQAMSYNKYFCYRNFWVHDEEGNECVFVKSTFVLMDQKNRKI
SSVLPEIIAPFDSEKITKIYRHEKIEKVTEGNFLPYRVRFFDIDGNQHVNNAIYFNWLLD
VLGYDFLTTHQPKKILVKFDKEVEYGQEVESHYEIVEQENQLKTRHEIRIDGQTYCEANI
DWTN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaaaacatacatcctcttatgaagttgcctactatgacggcgattttactggt
gcaatgaagataccggctttgttagcggttgtcattaaagtatcagaagaacaaacagaa
ttactaggaagagatgcggcttatgtcgctcaatttggtctaggctgggtcatcaccaat
tatgaaatagagattcatcgcttaccaaaagttggtgaaaaagtagcaattacaacgcaa
gctatgagttataacaaatatttttgttatcgtaacttttgggttcatgatgaagaaggc
aatgaatgtgtctttgtgaaatcaacctttgtcttaatggatcaaaaaaatcggaaaatc
agtagtgtgttaccagaaattattgcaccttttgattctgaaaaaatcactaaaatttat
cgccatgaaaaaattgaaaaggtcacagaggggaactttttaccttatcgtgtgcgtttt
tttgatattgatggcaatcaacatgttaataatgcgatttactttaattggttattggat
gtgttagggtatgactttttaacaacgcatcaaccgaaaaaaattcttgtgaaatttgat
aaagaagtagaatatggccaagaagtcgaaagtcattacgaaattgtcgaacaagaaaat
cagttgaaaacgcgccatgagattcggattgatggtcaaacctattgtgaagcgaatatc
gattggaccaactaa

DBGET integrated database retrieval system