KEGG   Enterococcus faecalis 62: EF62_1303Help
Entry
EF62_1303         CDS       T01881                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase/Methionine--tRNA ligase, MetRS
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00450  Selenocompound metabolism
efl00970  Aminoacyl-tRNA biosynthesis
efl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EF62_1303 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EF62_1303 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:efl01007]
    EF62_1303 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:efl03016]
    EF62_1303 (metG)
Enzymes [BR:efl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EF62_1303 (metG)
Amino acid related enzymes [BR:efl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EF62_1303 (metG)
Transfer RNA biogenesis [BR:efl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EF62_1303 (metG)
 Prokaryotic type
   Other AARSs
    EF62_1303 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF4455 tRNA-synt_1d
Motif
Other DBs
NCBI-ProteinID: ADX79549
Position
1291910..1293919
Genome map
AA seq 669 aa AA seqDB search
MSQKETFYITTPIYYPSGKLHIGNSYTTIACDAMARYKRLMGFDVFYLTGVDEHGQKIEK
KAAELNVTPKEYVDKMAADVQKLWKTLDISYDKFIRTTDDYHMAAVQQIFDRLVEQGDIY
LGEYEGWYSVSDEEFFTETQLAEVYRDDEGNVIGGKAPSGHEVELVKEESYFFRMSKYAD
RLVQYYEEHPEFIQPESRKNEMLNNFIKPGLEDLAVSRTTFSWGIPLKNDPKHVVYVWID
ALSNYITALGYGSEDDSLFQKYWPANVQMVGKEIVRFHTIYWPIMLMALDLPLPKKVFGH
GWLLMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLLRAIPFGSDGVFTPEDFVSRLNYD
LANDLGNLLNRTIAMINKYCDGKVPAYASKVTPFDSELSTTAANVIGKYHEAMEKMEFNT
AIAEIWTLVSRANKYIDETAPWVLAKEEEKRNELESVMIHLAESLRIVAILLQPVMTETP
GKIFEQLGLDPETMNMENIHFGEFPTDVTVTSKGTPIFPRLEIETEVTYIQKKMSQSESA
TEEDIKWNPEETTLVSTKEKQIKYDDFDKVELKVAEVIDCKKVKGADKLLQFRLDAGDEN
HRQILSGIAEFYPDPAALIGKKVVIVANLKPRKMRGQISQGMILSAESPEGKLQIVEAPK
EMPNGAGIA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagaaagaaacattttatattaccaccccaatttattacccaagtgggaagtta
catattgggaattcatatacaacaatcgcctgcgatgcaatggcccgttacaagcgttta
atgggttttgatgtattttatttaacaggtgtggatgaacacggccaaaaaattgaaaaa
aaagctgctgagttgaatgtgacaccaaaagagtacgttgataaaatggcagcagatgtt
caaaaattatggaaaacattagatatcagctatgataaatttattcggacaacggatgat
tatcacatggcagccgtgcaacaaatttttgatcgtttagtagaacaaggagatatctac
cttggagaatatgaaggttggtattcagtttctgatgaagaatttttcactgaaacacaa
ttagctgaagtatatcgtgacgatgaaggcaatgtcattggtgggaaagcaccaagtggt
cacgaagtcgaattagttaaagaagaatcctatttcttccgcatgagtaaatatgcggat
cgcttggtacaatattacgaagaacatccagaatttattcaaccagaatctcgtaaaaat
gagatgctaaataacttcatcaaaccaggattggaagatttagccgtttcaagaacgact
ttctcttggggaattccattaaaaaatgatccaaaacatgtggtttacgtatggattgat
gcgttatcaaactatattacagcactaggttatggttcagaagatgattcattattccaa
aaatattggcctgcgaacgtgcaaatggttgggaaagaaatcgtgcgtttccatacgatt
tattggccaattatgttaatggccttggatttaccattaccgaaaaaagtctttggacat
ggttggttattgatgaaagacgggaaaatgtctaaatctaaaggaaatgttgtttaccct
gaaatgttagtagaacgctacggtctagatgcgttacgttactatttattacgagcaatt
ccatttggtagtgatggcgtctttacaccagaagatttcgtttctcgcttaaattatgat
ttagctaatgacttaggaaacttgttgaatcgaacaattgcgatgattaataaatattgt
gatggcaaagtaccagcctatgcttcaaaagttaccccatttgatagtgaactatcgaca
actgcggctaatgttattggaaaatatcatgaagcaatggaaaaaatggaatttaatacg
gccattgcagaaatctggacgctagtttctcgtgccaataaatatattgatgaaacagcg
ccttgggtattggctaaagaagaagagaaacgcaatgaattagaaagtgtcatgatccat
ttagcggaaagcttacgaattgtggcaatcttattgcaaccagtcatgacagaaacacca
gggaaaattttcgaacaattaggcttagatccagaaacaatgaacatggaaaatattcat
tttggtgagttcccaacagacgtaacagtaacaagtaaaggaacacctattttcccacgt
ttagaaattgaaacagaagtaacgtatattcaaaagaaaatgtcccaaagcgaaagtgct
acagaagaggatattaaatggaatccagaagaaacaacgttggtttcaacgaaagaaaaa
caaattaagtacgatgatttcgataaagtggaattaaaagttgccgaagttattgactgt
aaaaaagtcaaaggagcagataaattattgcaatttcgtttagatgctggagatgaaaac
catcgtcaaattctttcaggtattgctgaattttatccagatccagctgcgctaattggc
aaaaaagtagtcattgtggctaacttaaaaccaagaaaaatgcgtggtcaaattagccaa
ggaatgattctttcagctgaatcaccagaaggtaaacttcaaattgttgaagcaccaaaa
gaaatgccaaatggtgcaggaattgcataa

DBGET integrated database retrieval system