KEGG   Enterococcus faecalis 62: EF62_1815Help
Entry
EF62_1815         CDS       T01881                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00071  Fatty acid degradation
efl00072  Synthesis and degradation of ketone bodies
efl00280  Valine, leucine and isoleucine degradation
efl00362  Benzoate degradation
efl00380  Tryptophan metabolism
efl00620  Pyruvate metabolism
efl00630  Glyoxylate and dicarboxylate metabolism
efl00640  Propanoate metabolism
efl00650  Butanoate metabolism
efl00900  Terpenoid backbone biosynthesis
efl01100  Metabolic pathways
efl01110  Biosynthesis of secondary metabolites
efl01120  Microbial metabolism in diverse environments
efl01130  Biosynthesis of antibiotics
efl01200  Carbon metabolism
efl01212  Fatty acid metabolism
efl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:efl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EF62_1815
   00630 Glyoxylate and dicarboxylate metabolism
    EF62_1815
   00640 Propanoate metabolism
    EF62_1815
   00650 Butanoate metabolism
    EF62_1815
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EF62_1815
   00072 Synthesis and degradation of ketone bodies
    EF62_1815
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EF62_1815
   00310 Lysine degradation
    EF62_1815
   00380 Tryptophan metabolism
    EF62_1815
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EF62_1815
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EF62_1815
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EF62_1815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:efl04147]
    EF62_1815
Enzymes [BR:efl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EF62_1815
Exosome [BR:efl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EF62_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF1134
Motif
Other DBs
NCBI-ProteinID: ADX80037
Position
1784859..1786049
Genome map
AA seq 396 aa AA seqDB search
MKTVVIIDALRTPIGKYKGSLSQVSAVDLGTHVTTQLLKRHSTISEEIDQVIFGNVLQAG
NGQNPARQIAINSGLSHEIPAMTVNEVCGSGMKAVILAKQLIQLGEAEVLIAGGIENMSQ
APKLQRFNYETESYDAPFSSMMYDGLTDAFSGQAMGLTAENVAEKYHVTREEQDQFSVHS
QLKAAQAQAEGIFADEIAPLEVSGTLVEKDEGIRPNSSVEKLGTLKTVFKEDGTVTAGNA
STINDGASALIIASQEYAEAHGLPYLAIIRDSVEVGIDPAYMGISPIKAIQKLLARNQLT
TEEIDLYEINEAFAATSIVVQRELALPEEKVNIYGGGISLGHAIGATGARLLTSLSYQLN
QKEKKYGVASLCIGGGLGLAMLLERPQQKKTADFIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacagtagttattattgatgcattacgaacaccaattggaaaatataaaggcagc
ttaagtcaagtaagtgccgtagacttaggaacacatgttacaacacaacttttaaaaaga
cattccactatttctgaagaaattgatcaagtaatctttggaaatgttttacaagctgga
aatggccaaaatcccgcacgacaaatagcaataaacagcggtttgtctcatgaaattccc
gcaatgacggttaatgaggtctgcggatcaggaatgaaggccgttattttggcgaaacaa
ttgattcaattaggagaagcggaagttttaattgctggtgggattgagaatatgtcccaa
gcacctaaattacaacgatttaattacgaaacagaaagctacgatgcgcctttttctagt
atgatgtacgatgggttaacggatgcctttagtggtcaggcaatgggcttaactgctgaa
aatgtggccgaaaagtatcatgtaactagagaagagcaagatcaattttctgtacattca
caattaaaagcagctcaagcacaagcagaagggatattcgctgacgaaatagccccatta
gaagtgtcaggaacgcttgtggagaaagatgaagggattcgccctaattcgagcgttgag
aagctaggaacgcttaaaacagtttttaaagaagacggtactgtaacagcagggaatgca
tcaaccattaatgatggggcttctgctttgattattgcttcacaagaatatgccgaagca
cacggtcttccttatttagctattattcgagacagtgtggaagtcggtattgatccagcc
tatatgggaatttcgccgattaaagccattcaaaaactgttagcgcggaatcaacttact
acggaagaaattgatctgtatgaaatcaacgaagcatttgcagcaacttcaatcgtggtc
caaagagaactggctttaccagaggaaaaggtcaacatttatggtggcggtatttcatta
ggtcatgcgattggtgccacaggtgctcgtttattaacgagtttaagttatcaattaaat
caaaaagaaaagaaatatggcgtggcttctttatgtatcggcggtggcttaggactcgct
atgctactagagagacctcagcaaaaaaaaacagccgattttatcaaatga

DBGET integrated database retrieval system