KEGG   Enterococcus faecalis 62: EF62_2121Help
Entry
EF62_2121         CDS       T01881                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00040  Pentose and glucuronate interconversions
efl00052  Galactose metabolism
efl00500  Starch and sucrose metabolism
efl00520  Amino sugar and nucleotide sugar metabolism
efl01100  Metabolic pathways
efl01130  Biosynthesis of antibiotics
Module
efl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EF62_2121 (galU)
   00052 Galactose metabolism
    EF62_2121 (galU)
   00500 Starch and sucrose metabolism
    EF62_2121 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EF62_2121 (galU)
Enzymes [BR:efl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EF62_2121 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADX80343
Position
complement(2104772..2105668)
Genome map
AA seq 298 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALASGIEDILIVTGKAK
RPIEDHFDSNVELENNLKEKNKTDLLKLVEETTDVNLHFIRQSHPKGLGHAVLQAKAFVG
NEPFVVMLGDDLMEDKVPLTKQLMDDYEQTHASTIAVMKVPHEDTSKYGIINPEKEIEKG
LYNVENFVEKPKPEEAPSDLAIIGRYLLTPEIFDVLENQKPGAGNEIQLTDAIDTLNKTQ
RVFAREFKGERYDVGDKFGFMKTSIEYGLTHPEVKDNLREYIINLGAQLAKKEQPKEK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaggcagttattccagcagctgggttaggaacacgtttcttgccggct
accaaagcgatggcaaaagaaatgttaccgattgttgataaaccaacgattcaatttatt
gtagaagaagcactagcttcaggaatcgaagatattttaattgtgacaggcaaagccaaa
cgtccgattgaagatcatttcgattcaaatgttgaattagaaaataacttaaaagaaaaa
aataaaaccgatttattgaaattagtcgaagaaacaacggatgttaatttacattttatt
cgtcaatcccatccgaaaggcttaggacacgctgttttacaagcgaaagcatttgttggc
aatgaaccttttgtcgtgatgttaggcgacgatttaatggaagataaagtgccattaacg
aaacaattaatggatgattacgaacaaacacatgcttcgacaattgcggtaatgaaagta
ccccatgaagatacttcaaaatatggtattatcaacccagaaaaagaaatcgaaaaagga
ctatacaatgtcgagaattttgttgaaaaaccaaaacccgaggaagcaccaagtgattta
gcgattatcggccgttatttattaacccctgaaatttttgatgtacttgaaaatcaaaaa
ccaggcgctggtaacgaaattcagttaacagatgcgattgacactttaaataaaacacaa
cgcgtttttgctcgtgagtttaaaggagaacgttacgatgttggcgataaatttgggttt
atgaaaacaagcattgaatatggtttgactcatccagaagtaaaagataatttacgagaa
tacattattaatttaggtgctcaattagcgaaaaaagagcaaccaaaagaaaaataa

DBGET integrated database retrieval system