KEGG   Enterococcus faecalis 62: EF62_2577Help
Entry
EF62_2577         CDS       T01881                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00030  Pentose phosphate pathway
efl01100  Metabolic pathways
efl01120  Microbial metabolism in diverse environments
efl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:efl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EF62_2577
Enzymes [BR:efl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     EF62_2577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ADX80786
Position
2567159..2567938
Genome map
AA seq 259 aa AA seqDB search
MYGELHGKVAVVTGAATGLGLFITLRYILEGMNVVADYVGELPKEFEDVQAKHADRVKFV
KADVSNEEDIKALAETALKEFGHVDIWVNNAGVEASFPTIDMPLKEWQRVIDVNLNGVFL
GSREALRIFRDQKIKGSIINMSSVHQRIPWPTFAHYAASKGATEMFTKTIALEYAEYGIR
ANCIAPGAINTPINAEKFSDPEQLKQTTSMVPMGIIGKPNQVAAAAAWLASDESSYVTGT
TLFVDGGMSLYTSFQHGAG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtatggagaattacatggtaaagtggccgttgtcactggtgcagctacgggtttagga
ttatttattactctgcgttatatcttagagggcatgaatgttgttgctgactatgtcggt
gagctgcctaaagaatttgaagatgtccaagccaagcacgcagaccgcgtaaaattcgtg
aaggctgatgtctctaatgaagaagatattaaagcgttagctgaaaccgctttaaaagag
tttggtcatgttgacatttgggtaaataacgccggtgtggaggcttcttttccgacaatt
gatatgccattaaaagaatggcaacgtgtcattgatgtcaatttaaacggtgtctttttg
ggttctagagaggcactccgaatatttagagatcaaaaaatcaaagggtcaatcattaat
atgtcctccgttcaccaaagaattccttggccaacgttcgcccactatgcggcaagtaaa
ggtgcaaccgaaatgttcacgaaaacaatcgctttggaatatgcggaatatggtattcgt
gccaactgtattgcacctggagcgattaacacacctattaatgctgaaaaattttccgat
cccgaacagttaaaacaaacaacgagcatggttcctatgggcattattggtaaaccaaat
caagtagctgctgcggccgcttggttagcttctgatgaatcctcatacgtaactggaaca
acactctttgtagatggcgggatgtctctatacacttcgttccaacacggagctggttaa

DBGET integrated database retrieval system