KEGG   Enterococcus faecalis 62: EF62_2661Help
Entry
EF62_2661         CDS       T01881                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
efl  Enterococcus faecalis 62
Brite
KEGG Orthology (KO) [BR:efl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EF62_2661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADX80870
Position
complement(2646643..2647677)
Genome map
AA seq 344 aa AA seqDB search
MKNGGVFVSIALLVTITLVMGVIFVNGWTDAPNAIATAVSTRVLKPNVAIWMAVVMNFLG
ALVMTFFNAQVAETISNIVSFDANGNASQVALAASLFSIVVWAVAAWYFGIPTSESHALI
AGLTGSAMALGGLGAVNGSEWIKVLVGLVVSTVMGFGGGYLIAKLVVKAFSAVPRRKANK
FFTVGQAFGAGANAFLHGAQDGQKFMGVFMLVLFYNNLVEKTGGGFVIPLWVMVLCSITM
GIGTSVGGMRIIKSVGMDMVKLERYQGFTADLSTAICLFLASAFGIPVSTTHTKTTAIMG
VGASKRISSVDWRIVKEMLIAWILTFPGCGLIAYVMSKLFIAIF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatggtggtgtctttgtgagtattgcattattggtaacgattactttggtaatg
ggtgtaatttttgttaacggttggacggatgcgccgaacgcaattgcaaccgctgtctcg
actcgggtgttaaaaccgaatgtcgcaatttggatggctgttgtgatgaactttttaggt
gcattagtcatgaccttttttaatgcccaagtagctgaaacgattagcaacattgttagt
tttgacgcaaatggaaacgcttcacaggtggctttggctgcttcgcttttttcaattgtg
gtttgggcagttgctgcgtggtattttggtattcccacaagtgaaagccatgcgttaatt
gccggcttgactggttcggcaatggcattaggtggtttgggtgcagtcaatggctcggaa
tggatcaaagtgcttgttggtctagttgtttctaccgttatgggctttggcggcggttat
ttgattgccaaacttgttgtgaaagctttctcggctgtgcctagaagaaaagccaacaaa
ttttttacagttggacaagcctttggtgcaggagctaatgcttttttacatggtgcgcaa
gatgggcaaaaatttatgggcgtgttcatgttagtgcttttttataataatttagtcgaa
aaaacaggtggcggttttgtgattccgttatgggttatggttctgtgttccattacaatg
ggcattggaacttctgtgggcggcatgagaatcattaaatcagtcgggatggatatggta
aaacttgaacgctatcaaggcttcactgcagatttaagcacggctatttgtttattttta
gcatcggcttttgggattccagtttcaactactcatacaaaaacaacagcgattatggga
gtaggtgcttctaagcgaatctcaagtgttgactggcgtatcgtgaaagaaatgctgata
gcatggattttaactttcccaggatgtgggctgatcgcttatgtgatgtcaaaattattt
attgcaattttttaa

DBGET integrated database retrieval system