KEGG   Enterococcus faecalis 62: EF62_2919Help
Entry
EF62_2919         CDS       T01881                                 

Gene name
tenA
Definition
(GenBank) thiaminase-2 like Transcriptional activator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00730  Thiamine metabolism
efl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EF62_2919 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:efl03000]
    EF62_2919 (tenA)
Enzymes [BR:efl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     EF62_2919 (tenA)
Transcription factors [BR:efl03000]
 Prokaryotic Type
  Other transcription factors
   Others
    EF62_2919 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 NVEALA Haem_oxygenas_2
Motif
Other DBs
NCBI-ProteinID: ADX81127
Position
complement(2921698..2922360)
Genome map
AA seq 220 aa AA seqDB search
MTFTEQAKEQAQASWQGSFQHPFITELHEGTLSPTIFRYYLIQDHYYLKHFSQLYRLIAA
QTQQPRLKKLLLTNAESLALGELAIRETFFEELAITEEEVAATPIAPTAYHYVSHMYRQL
IEGTPKTAAASMLPCSWLYQEIGAQLVKQHSPEPLYQRWIETYAGEEAYQHVQEERQLLD
QLYEESSPQEQAAMITAFVISSEMEYAFWEMAYTHETWIG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgacatttacagaacaagccaaagaacaagcgcaagcttcttggcaaggaagttttcag
catccttttatcacagagttacatgaaggaaccttgagtccaacgatttttcgctactat
ttaattcaagatcattactatttaaaacattttagtcagctttatcgcttgattgcggca
caaacgcaacaacctcgattgaaaaaattactcttaacaaatgcggaaagtctcgcgttg
ggcgaattagctattcgtgaaactttttttgaagaactagcgattacagaagaagaagtt
gcagcgacaccgattgcaccaaccgcttatcactatgtttctcatatgtatcgccaactt
attgaaggaacgcctaagacggccgcagcaagtatgttgccttgttcttggctctatcaa
gaaattggtgcacagttagtcaaacaacactcaccagagccactgtaccaacgttggatt
gaaacctatgctggggaggaagcgtaccaacacgtccaagaggaacgccaactgttagac
caattatatgaagaaagttcaccacaagaacaagcagctatgatcaccgcttttgttatc
agcagtgagatggaatacgctttttgggaaatggcctatacacacgaaacctggattggt
taa

DBGET integrated database retrieval system