KEGG   Enterococcus faecalis DENG1: DENG_00189Help
Entry
DENG_00189        CDS       T03043                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
efn  Enterococcus faecalis DENG1
Pathway
efn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:efn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DENG_00189 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:efn03011]
    DENG_00189 (rplV)
Ribosome [BR:efn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DENG_00189 (rplV)
  Bacteria
    DENG_00189 (rplV)
  Archaea
    DENG_00189 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHI39309
Position
176105..176452
Genome map
AA seq 115 aa AA seqDB search
MSEQITSAKATAKTVRTSPRKARLVIDLIRGKSVADAISILKFTPNKSAGIIEKVLMSAV
ANAENNFDLDVESLVVSEAFVNEGPTMKRFRPRAKGSASPINKRTSHITVVVTEK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaaattacatcagctaaagcaactgcaaaaacagttcgcacttcacctcgt
aaagcacgtttagtaatcgatcttatcagagggaaaagcgttgcggatgcaatttcaatc
ttgaaattcacaccgaacaagtctgctggaatcattgaaaaagttttaatgtcagcagtt
gctaacgcagaaaacaactttgacttagacgttgaaagcttagtcgtatctgaagcattt
gttaacgaaggaccaacaatgaaacgtttccgtcctcgtgcaaaaggttcagcttcacca
atcaacaaacgtactagtcacatcacagtagttgtaacagagaaataa

DBGET integrated database retrieval system