KEGG   Enterococcus faecalis DENG1: DENG_00985Help
Entry
DENG_00985        CDS       T03043                                 

Gene name
mars
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
efn  Enterococcus faecalis DENG1
Pathway
efn00450  Selenocompound metabolism
efn00970  Aminoacyl-tRNA biosynthesis
efn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DENG_00985 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DENG_00985 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:efn01007]
    DENG_00985 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:efn03016]
    DENG_00985 (mars)
Enzymes [BR:efn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DENG_00985 (mars)
Amino acid related enzymes [BR:efn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DENG_00985 (mars)
Transfer RNA biogenesis [BR:efn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DENG_00985 (mars)
 Prokaryotic type
   Other AARSs
    DENG_00985 (mars)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF4455 tRNA-synt_1d
Motif
Other DBs
NCBI-ProteinID: AHI40019
Position
867826..869835
Genome map
AA seq 669 aa AA seqDB search
MSQKETFYITTPIYYPSGKLHIGNSYTTIACDAMARYKRLMGFDVFYLTGVDEHGQKIEK
KAAELNVTPKEYVDKMAADVQKLWKTLDISYDKFIRTTDDYHMAAVQQIFDRLVEQGDIY
LGEYEGWYSVSDEEFFTETQLAEVYRDDEGNVIGGKAPSGHEVELVKEESYFFRMSKYAD
RLVQYYEEHPEFIQPESRKNEMLNNFIKPGLEDLAVSRTTFSWGIPLKNDPKHVVYVWID
ALSNYITALGYGSEDDSLFQKYWPANVQMVGKEIVRFHTIYWPIMLMALDLPLPKKVFGH
GWLLMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLLRAIPFGSDGVFTPEDFVSRLNYD
LANDLGNLLNRTIAMINKYCDGKVPAYASKVTPFDSELSTTAANVIGKYHEAMEKMEFNT
AIAEIWTLVSRANKYIDETAPWVLAKEEEKRNELESVMIHLAESLRIVAILLQPVMTETP
GKIFEQLGLDPETMNMENIHFGEFPTDVTVTSKGTPIFPRLEIETEVTYIQKKMSQSESA
TEEDIKWNPEETTLVSTKEKQIKYDDFDKVELKVAEVIDCKKVKGADKLLQFRLDAGDEN
HRQILSGIAEFYPDPAALIGKKVVIVANLKPRKMRGQISQGMILSAESPEGKLQIVEAPK
EMPNGAGIA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagaaagaaacattttatattaccaccccaatttattacccaagtgggaaatta
catattgggaattcatatacaacaatcgcctgcgatgcaatggcccgttacaagcgttta
atgggtttcgatgtattttatttaacaggtgtggatgaacatggccaaaaaattgaaaaa
aaagctgctgagttgaatgtgacaccaaaagagtacgttgataaaatggcagcagatgtt
caaaaattatggaaaacattagatatcagctatgataaatttattcggacaacggatgat
tatcacatggcagccgtgcaacaaatttttgatcgtttagtagaacaaggagatatctac
cttggagaatatgaaggttggtattcagtttctgatgaagaatttttcactgaaacacaa
ttagctgaagtatatcgtgacgatgaaggcaatgtcattggtgggaaagcaccaagtggt
cacgaagtcgaattagttaaagaagaatcctatttcttccgcatgagtaaatatgcggat
cgcttggtacaatattacgaagaacatccagaatttattcaaccagaatctcgtaaaaat
gagatgctaaataactttatcaaaccaggattagaagatttagccgtttcaagaacgact
ttctcttggggaattccattaaaaaatgatccaaaacatgtggtttacgtatggattgat
gcgttatcaaactatattacagcactaggttatggttcagaagatgattcattattccaa
aaatattggcctgcgaacgtgcaaatggttgggaaagaaatcgtgcgtttccatacgatt
tattggccaattatgttaatggccttggatttaccattaccgaaaaaagtctttggacat
ggttggttattgatgaaagacggaaaaatgtctaaatctaaaggaaatgttgtttaccct
gaaatgttagtagaacgctacggtctagatgcgttacgttattatttattacgagcaatt
ccatttggtagtgacggcgtctttacaccagaagatttcgtttctcgcttaaattatgat
ttagctaatgacttaggaaacttgttgaatcgaacaattgcgatgattaataaatattgt
gatggcaaagtaccagcctatgcttcaaaagttaccccatttgatagtgaactatcgaca
actgcggctaatgttattggaaaatatcatgaagcaatggaaaaaatggaatttaatacg
gccattgcagaaatttggacgctagtttctcgtgccaataaatatattgatgaaacagcg
ccttgggtattggctaaagaagaagagaaacgcaatgaattagaaagtgtcatgatccat
ttagcggaaagcttacgaattgtggcaatcttattgcaaccagtcatgacagaaacacca
gggaaaattttcgaacaattaggcttagatccagaaacaatgaacatggaaaatattcat
tttggtgagttcccaacagacgtaacagtaacaagtaaaggaacacctattttcccacgt
ttagaaattgaaacagaagtaacgtatattcaaaagaaaatgtcccaaagcgaaagtgct
acagaagaggatattaaatggaatccagaagaaacaacgttggtttcaacgaaagaaaaa
caaattaagtacgatgatttcgataaagtggaattaaaagttgccgaagttattgactgt
aaaaaagtcaaaggagcagataaattattgcaattccgtttagatgctggagatgaaaac
catcgtcaaattctttcaggtattgctgaattttatccagatccagctgcgctaattggc
aaaaaagtagtcattgtggctaacttaaaaccaagaaaaatgcgtggtcaaattagccaa
ggaatgattctttcagctgaatcaccagaagggaaacttcaaattgttgaagcaccaaaa
gaaatgccaaatggtgcaggaattgcataa

DBGET integrated database retrieval system