KEGG   Enterococcus faecalis DENG1: DENG_03021Help
Entry
DENG_03021        CDS       T03043                                 

Gene name
uxuA
Definition
(GenBank) Mannonate dehydratase
  KO
K01686  mannonate dehydratase [EC:4.2.1.8]
Organism
efn  Enterococcus faecalis DENG1
Pathway
efn00040  Pentose and glucuronate interconversions
efn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DENG_03021 (uxuA)
Enzymes [BR:efn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.8  mannonate dehydratase
     DENG_03021 (uxuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UxuA AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AHI41845
Structure
PDB: 

Position
complement(2755841..2756914)
Genome map
AA seq 357 aa AA seqDB search
MKWGFRWYGAAGDAIPLKHIRQIPGITGVVGTLLNKLPGDVWTVAEIQALKQSVEQEGLA
LLGIESVAIHDAIKAGTDQRDHYIDNYRQTLRNLGKCGISLVCYSFKPIFGWAKTDLAYE
NEDGSLSLLFDQAVVENMEAEDMYQLIHSQSKGFRLPGWEEERLQQFQELKAMYAGVTEE
DLVENLRYFLERVIPVCEEENIKMGIHPDDPPWEIFGLPRITKNLADLKRILSLVDSPAN
GITFCTGSLGADPTNDLPTMIREIGHRINFVHFRNVKYLGEHRFEETAHPSVAGSLDMAE
LMQALVDVGYEGVIRPDHGRAIWDEKAMPGYGLYDRAMGLTYIQGLYEATKAKQNRK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggggatttagatggtacggagcggcaggcgatgccattccgttaaaacatatt
cgacagattccaggaattactggtgttgtcggtaccttgttaaataaactaccaggtgat
gtttggacagtagccgaaattcaggcacttaaacaatcggtggaacaagaaggattagca
cttttaggaattgaaagtgttgctattcatgatgccattaaagcgggaacggatcaacga
gaccactatattgataattatcgccaaacgttgcgtaacttggggaaatgtggaatttcc
ttagtgtgctacagcttcaaacctatttttggttgggctaaaacggacttggcgtatgag
aatgaagatggtagcttatcgttgttatttgatcaagctgtggtagagaacatggaggca
gaagacatgtatcaattaattcacagtcagtcaaaaggattccggttaccaggttgggaa
gaggagcgtttgcaacaatttcaagaattgaaagccatgtatgccggcgtaacagaagaa
gatttggtcgaaaatttgcgctactttttagaacgtgtgattcctgtctgtgaagaagaa
aatatcaaaatggggattcaccccgatgatccaccttgggaaatttttggtttgccaaga
atcactaaaaatttagcggatttaaaacggatcctttccttggtggactcaccagcaaat
gggattacattttgtacaggttccctcggtgcggacccgacgaatgatttgcctactatg
attcgtgaaataggtcacagaattaattttgttcatttccgcaatgtgaagtatttaggt
gagcatcgttttgaagaaacggcgcatccgagtgtcgctggttcgttagatatggcggaa
ttaatgcaagcactggtagacgtagggtatgaaggtgttattcgtcctgaccatgggcgg
gcaatttgggatgaaaaagcgatgcctggttatggtttatatgatcgagcaatggggttg
acctatattcaaggactgtacgaagcaaccaaagccaaacaaaataggaagtga

DBGET integrated database retrieval system