KEGG   Enterococcus faecalis ATCC 29212: DR75_205Help
Entry
DR75_205          CDS       T03320                                 

Gene name
dapD
Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
efq  Enterococcus faecalis ATCC 29212
Pathway
efq00300  Lysine biosynthesis
efq01100  Metabolic pathways
efq01110  Biosynthesis of secondary metabolites
efq01230  Biosynthesis of amino acids
Module
efq_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:efq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    DR75_205 (dapD)
Enzymes [BR:efq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     DR75_205 (dapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AIL05820
Structure
PDB: 

Position
194321..195022
Genome map
AA seq 233 aa AA seqDB search
MDAYEIIQYIGDAKKQTPVKVTLKGQLKEVTFPETIKVFNNCKTGTLFGDWADVKPFLEA
NKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAV
VGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEG
VRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDDKTKSKTEILEELRKL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttggacgcatatgagattattcagtatattggcgatgccaaaaagcaaacgcctgttaaa
gtaacactgaaagggcaattaaaagaagtcacgtttccggaaacaattaaggtctttaat
aattgtaaaactgggacattgtttggcgattgggctgacgtaaaaccttttttagaagca
aacaaagaaaaaattgaggattatgttgtagaaaacgatgcacgtaactcagcaattcct
tttcttgatctgaaagacattaatgctcggattgaaccaggtgctttgattcgcgaaaaa
gttgaaattggcgatcaagcggtgattatgatgggggctattctaaatattggcgccgtc
gttggtgcagggactatgattgatatgggcgctgttttgggcggtcgtgcaactgtaggg
aagcattgtcatattggcgcaggaacggttttagctggtgtcattgaaccaccaagtgcc
gcacctgtggttattgaaaacgaggttgtcattggagcgaatgcggtcgtactagaaggg
gttcgtgttggtgaaggtgccgttgtggctgctggggcagtagttgtggaagacgttcca
gcgcataccgttgttgcaggcgtgccagcaaaagtaattaaacaaattgatgataaaacc
aagagtaaaacagagattttagaagaattacgtaaactctaa

DBGET integrated database retrieval system