KEGG   Enterococcus faecalis ATCC 29212: DR75_942Help
Entry
DR75_942          CDS       T03320                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
efq  Enterococcus faecalis ATCC 29212
Pathway
efq00430  Taurine and hypotaurine metabolism
efq00620  Pyruvate metabolism
efq00640  Propanoate metabolism
efq00680  Methane metabolism
efq01100  Metabolic pathways
efq01120  Microbial metabolism in diverse environments
efq01200  Carbon metabolism
Module
efq_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:efq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR75_942 (ackA)
   00640 Propanoate metabolism
    DR75_942 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    DR75_942 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DR75_942 (ackA)
Enzymes [BR:efq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     DR75_942 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AIL05611
Position
complement(957848..959035)
Genome map
AA seq 395 aa AA seqDB search
MSKTIAINAGSSSLKWQLYQMPNEEVIAKGIVERIGLKDSIFTIKYGEGQKYEVIVDIDN
HEVAVKMLLDQLIDLNILGSYDEITGVGHRVVAGGEEFKDSVVITDEVLEKIEALSELAP
LHNPANAMGIKAFKHILPEIISVAVFDTSFHTTMPEHNYLYSVPREYYEKFAARKYGAHG
TSHRYVSQRAAEMLGRPIEDLKIITCHLGNGASITAVDGGKSVDTSMGFTPLAGVTMGTR
SGDVDASLLPYLMTKLGLTDVQDMVDILNKKSGLLGLTNGLSSDMRDIQSNLDKPEVQTA
YNIFIDRIRKYIGSYVTVMNGVDAIVFTAGIGENAVGVRKDIIDGMTWFGCEIDDDKNNV
HGEEAVISTDDSKIKLLLVPTDEELMIARDVERLK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaacaattgcaattaatgcaggtagttcaagtttaaaatggcaattataccaa
atgccaaatgaagaagtgatcgctaaaggaatcgttgaacgtattggcttaaaagattct
atcttcacaattaaatatggtgaaggacaaaaatatgaagtaattgttgatattgataac
catgaagtggcagtaaaaatgttactagaccaattaatcgacttaaacattttaggttct
tatgatgaaattactggtgttggtcaccgtgtagttgctggtggagaagaatttaaagat
tctgttgttattacagacgaagtattagaaaaaattgaagctttatctgaattagcacct
ttacacaacccagcgaatgcaatggggattaaagcatttaaacatatcttaccagaaatc
attagcgtggcagtctttgatacgtcgttccacacaacaatgccagaacacaactattta
tatagtgtaccgcgtgaatactatgaaaaatttgctgcacgtaaatatggggcacatgga
acaagtcatcgttatgtctctcaacgtgctgcagaaatgttaggtcgtccaattgaagac
ttgaaaattatcacttgtcacttaggaaatggtgcttcaatcactgcagttgatggtggt
aaatcagtcgatacatcaatgggcttcactcctcttgctggcgttacaatggggactcgt
tcaggggatgttgatgcgtcactattgccttatttaatgacaaaacttggcttgactgat
gtacaagacatggttgatattttaaacaaaaaatctggtttattaggtttaacaaatggt
ttatcaagcgacatgcgcgatattcaatcaaacttagataaacctgaagttcaaacagca
tacaacatttttatcgatcgtattcgtaaatacattggtagctatgtcactgttatgaat
ggcgttgatgcgattgtctttactgctggaatcggtgaaaatgcagttggcgttcgtaaa
gatattattgatggcatgacttggtttggttgtgaaatcgatgatgacaaaaataatgta
cacggtgaagaagcagttatctcaactgatgattcaaaaatcaagcttctattagtacca
actgatgaagagttaatgattgcccgtgacgtagaacgtctaaaataa

DBGET integrated database retrieval system