KEGG   Entomoplasma freundtii: EFREU_v1c01370Help
Entry
EFREU_v1c01370    CDS       T05222                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
efr  Entomoplasma freundtii
Pathway
efr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:efr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EFREU_v1c01370 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:efr03011]
    EFREU_v1c01370 (rplV)
Ribosome [BR:efr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EFREU_v1c01370 (rplV)
  Bacteria
    EFREU_v1c01370 (rplV)
  Archaea
    EFREU_v1c01370 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF1687
Motif
Other DBs
NCBI-ProteinID: ATZ16164
UniProt: A0A2K8NQV1
Position
172738..173076
Genome map
AA seq 112 aa AA seqDB search
MEAKAQLSMIRISPRKVRLVVDTIRNKPVSQAVSILNNLDKAASEPVLKLLNSAIANAVN
NNGMEADRLYIKTAYVNEGPTLKRFRPRAQGRAFEILKRTSHITIVVSDEMK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcacaattaagcatgattcgtatctctcctcgtaaagttcgtttagta
gtagataccattcgtaataaaccagtttcacaagcagtttcaatcctaaacaatttggat
aaagcggctagtgaaccagttttaaaacttttaaactcagctatcgctaacgctgttaat
aacaacggaatggaagctgaccgtttatacatcaaaaccgcttatgtaaacgaaggacca
actttaaaacgtttccgtcctcgtgcacaagggcgcgcatttgaaattttaaaaagaact
agtcacatcacaattgttgttagtgacgaaatgaaatag

DBGET integrated database retrieval system