KEGG   Enterococcus faecalis Symbioflor 1: EFS1_0995Help
Entry
EFS1_0995         CDS       T02399                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
efs00010  Glycolysis / Gluconeogenesis
efs00030  Pentose phosphate pathway
efs00051  Fructose and mannose metabolism
efs00680  Methane metabolism
efs01100  Metabolic pathways
efs01110  Biosynthesis of secondary metabolites
efs01120  Microbial metabolism in diverse environments
efs01130  Biosynthesis of antibiotics
efs01200  Carbon metabolism
efs01230  Biosynthesis of amino acids
Module
efs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:efs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFS1_0995 (fba)
   00030 Pentose phosphate pathway
    EFS1_0995 (fba)
   00051 Fructose and mannose metabolism
    EFS1_0995 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    EFS1_0995 (fba)
Enzymes [BR:efs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     EFS1_0995 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase ThiG TMP-TENI DUF1611_N IMPDH BKACE
Motif
Other DBs
NCBI-ProteinID: CCO72073
Position
1024844..1025713
Genome map
AA seq 289 aa AA seqDB search
MPVVSGAEFLKAARKGGYAVGGYNTNNLEWTQAILEAAEAKKAPVLIQTSMGAAKYMGGY
KVAKDMITNLVDSMNITVPVAIHLDHGDYEAALECIEVGYTSIMFDGSHLPFEENLKLAK
DVVEKAHAKGISVECEVGSIGGEEDGIIGTGELADIEECKQMVATGIDYLACGIGNIHGQ
YPENWKGLAFDHLQAIAEAVGSDVPLVLHGGSGIPQEQIEKAISMGISKVNVNTEFQLSF
AKATREYIEAGKDLEGKGFDPRKLLAPGKAAIIKDAEEHIDWFGSANKA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccagtagtatcaggagcagaattcttaaaagcagcacgtaaaggcggctatgcagta
ggtggctataacacaaataacttagaatggacacaagcgattttagaagcagcagaagct
aaaaaagcaccagttctaatccaaacatcaatgggcgctgctaaatacatgggcggctac
aaagtagctaaagacatgattactaatttagtagactcaatgaatatcacagttccagta
gcaattcacttagaccacggtgactacgaagctgctttagaatgtatcgaagttggctat
acttcaatcatgtttgatggttctcacttaccattcgaagaaaacttaaaattagcgaaa
gatgtagttgaaaaagctcacgctaaaggtatatctgttgaatgtgaagttggttcaatc
ggtggtgaagaagacggaatcatcggtactggcgaattagctgatatcgaagaatgtaaa
caaatggttgctacaggtattgactacttagcatgtggtatcggtaacatccatggtcaa
tatccagaaaactggaaaggtttagcatttgatcacttacaagcaattgctgaagctgtc
ggttctgatgtacctctagtattacacggaggttctggtattcctcaagaacaaattgaa
aaagcaatttcaatgggtatctcaaaagttaacgtaaatacagaattccaattatcattc
gctaaagcaacgcgcgaatatattgaagctggtaaagatttagaaggtaaaggatttgac
cctcgtaaattattagcaccaggtaaagctgcaatcatcaaagatgcagaagaacacatt
gattggttcggttcagctaacaaagcttaa

DBGET integrated database retrieval system