KEGG   Enterococcus faecalis Symbioflor 1: EFS1_1013Help
Entry
EFS1_1013         CDS       T02399                                 

Definition
(GenBank) hydrolase, haloacid dehalogenase-like family
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
efs00627  Aminobenzoate degradation
efs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:efs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EFS1_1013
Enzymes [BR:efs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     EFS1_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 DRTGG DUF2529
Motif
Other DBs
NCBI-ProteinID: CCO72091
Structure
PDB: 

Position
1040530..1041300
Genome map
AA seq 256 aa AA seqDB search
MKKDYQGYLIDLDGTIYLGKEPIPAGKRFVEQLQEKDLPFLFVTNNTTKSPETVAQRLAN
EFDIHVPASLVYTATLATIDYMKETNRGKKVFVIGEAGLIDLILEAGFEWDETNPDYVVV
GLDTELSYEKVVLATLAIQKGALFIGTNPDKNIPTERGLLPGAGSVVTFVETATQTKPVY
IGKPKAIIMERAIAHLGVEKEQVIMVGDNYETDIQSGIQNGIDSLLVTSGFTPKSAVPTL
PTPPTYVVDSLDEWTF
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagactatcaaggatatttaattgatttagatggaacgatttatttaggaaaa
gaaccaattccagccggaaaacgttttgtcgagcagttacaggaaaaagatttgcctttt
ttatttgtaacgaataataccactaaatctcctgaaacagtggcacaacgtttagcaaat
gaatttgatattcatgtcccagcatcccttgtttatacagcgactttagcgacgattgat
tacatgaaagaaaccaatcgaggcaagaaagtctttgtcatcggcgaggctggtttaatt
gacttaattttagaagcaggttttgaatgggatgaaacaaaccctgattatgttgtcgtg
ggacttgatacagaattatcttatgaaaaagtggttttagctaccttagccattcaaaaa
ggggcgttgtttattgggaccaatccagataagaacattccgacagaaagaggcttatta
cctggtgcaggttcagttgtgacgtttgtggagacagctactcaaacaaaaccagtttat
attggcaaaccaaaagcgattatcatggaacgagcgattgcgcatttaggcgtggaaaaa
gagcaagtaattatggttggagataattatgaaaccgatattcaatcagggattcaaaat
ggtattgatagcttgttagttacatcaggttttacccctaagtcagctgttccaactttg
ccaacgccaccaacctatgttgttgattccttagatgaatggactttttga

DBGET integrated database retrieval system