KEGG   Enterococcus faecium T110: M395_06890Help
Entry
M395_06890        CDS       T03257                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eft  Enterococcus faecium T110
Pathway
eft00071  Fatty acid degradation
eft00072  Synthesis and degradation of ketone bodies
eft00280  Valine, leucine and isoleucine degradation
eft00362  Benzoate degradation
eft00380  Tryptophan metabolism
eft00620  Pyruvate metabolism
eft00630  Glyoxylate and dicarboxylate metabolism
eft00640  Propanoate metabolism
eft00650  Butanoate metabolism
eft00900  Terpenoid backbone biosynthesis
eft01100  Metabolic pathways
eft01110  Biosynthesis of secondary metabolites
eft01120  Microbial metabolism in diverse environments
eft01130  Biosynthesis of antibiotics
eft01200  Carbon metabolism
eft01212  Fatty acid metabolism
eft02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M395_06890
   00630 Glyoxylate and dicarboxylate metabolism
    M395_06890
   00640 Propanoate metabolism
    M395_06890
   00650 Butanoate metabolism
    M395_06890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M395_06890
   00072 Synthesis and degradation of ketone bodies
    M395_06890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M395_06890
   00310 Lysine degradation
    M395_06890
   00380 Tryptophan metabolism
    M395_06890
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M395_06890
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M395_06890
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M395_06890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eft04147]
    M395_06890
Enzymes [BR:eft01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M395_06890
Exosome [BR:eft04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M395_06890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AII40487
UniProt: A0A076GU29
Position
1398461..1400902
Genome map
AA seq 813 aa AA seqDB search
MKEVVMIDAARTPIGKYRGSLSSFTAVELGTLVTKELLDKTKLKKDKIDQVIFGNVLQAG
NGQNVARQIALNSGIPVDVPAMTINEVCGSGMKAVILARQLIQLGEAELVVAGGTESMSQ
APMLKPYQSETNEYGEPISSMVNDGLTDAFSNAHMGLTAENVATQFSVSREEQDRYALAS
QLKAAQAVEAGVFAEEIIPVKISAEDVLSEDEAVRGNSTLEKLGTLRTVFSEEGTVTAGN
ASPLNDGASVVILASKEYAENNNLPYLAIIKEVAEVGIDPSIMGISPITAIQKLTDKAGI
ALPTIDLFEINEAFAASSIVVNRELKLDEEKINIYGGAIALGHPIGASGARILTTLSHGL
LREQKRYGIASLCVGGGLGLAVLLEANTEQTREDLQKKKFYQLTPSERRSQLVEKGVLTQ
ENALIFEEQTLSEERSDHMIENQVSEVEIPMGIAQNFQINGKKKWIPMATEEPSVIAAAS
NGAKICGNICAETPQRLMRGQIVLSGKSEYQAVIDAVNHRKEELILCANESYPSIVKRGG
GVQDISTREFMGSFHAYLSIDFLVDVKDAMGANMINSILESVANKLREWFPEEEILFSIL
SNFATESLASACCEIPFERLGRSKEIGEQIAKKIQQAGEYAKLDPYRAATHNKGIMNGIE
AVVAATGNDTRAVSASIHAYAARNGLYQGLTDWQIKENKLVGKLTVPLAVATVGGASNIL
PKAKVSLAMLDVDSAKELAQVMAAVGLAQNLAALRALVTEGIQKGHMGLQARSLAISIGA
VGEEIEQVAQKLREAEKMNQQTAIQLLDKIREK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaagtcgtaatgatagatgctgcaagaacgccaataggaaagtatcgcggaagt
ttaagttcatttactgcagttgaattaggcacacttgtgaccaaagaattattagataaa
acaaaactgaaaaaagataaaatagatcaagtaatattcgggaatgtcctgcaggctggt
aatggtcaaaatgttgctagacaaattgctttgaacagcggtatcccagtggatgtccct
gcaatgacaatcaatgaagtttgtggatctggtatgaaagcagtgattttagcacgccag
ctgatccaattaggtgaagcagagcttgtggtagccggcggaacagagagtatgtctcaa
gcacctatgctgaaaccctatcagtcagaaacaaatgaatatggcgaaccaatttccagt
atggtcaatgacggattgactgacgcattttcaaatgcacatatgggattaaccgcagag
aatgtggcaactcaattttctgtgagcagagaagagcaggatcgttatgccttggcatct
cagttgaaagcagctcaagctgttgaagctggcgtatttgctgaggagattattccggtc
aagatttctgctgaagacgtgttatctgaggatgaagcagttcgtggaaatagtacattg
gaaaaattgggtacattacgtacagtattctcggaagaaggaacagtaacagcaggcaat
gcttctccattgaatgacggtgcctcagtggtgatccttgcatccaaagaatacgcagag
aataataatctgccttatttggcaatcatcaaagaagtagcggaagttggtattgatcca
agcatcatgggaatttctccaatcacagctattcaaaaattgacagataaagcaggaata
gctttaccaacgatcgatctttttgaaatcaatgaagcatttgcggcttcatctatcgtg
gtcaatcgagaactaaagttagatgaagaaaagatcaatatctatggaggagcaatcgca
ttaggacatccaattggggcaagcggtgcgcgtattttgaccacgttatcccacggattg
cttcgtgagcagaaaagatacgggattgcttcattatgtgttggcggaggtttaggcttg
gcagtcttgctagaagcgaatacggagcaaacacgtgaggatttgcaaaaaaaaaagttc
tatcagctcacgccatctgaacggcgcagtcaattagtcgaaaaaggtgtattgacacag
gaaaatgcactgatttttgaggaacaaacactttctgaagagcgctcagatcacatgatt
gaaaaccaagtgagcgaagtggaaatcccaatgggcattgcgcaaaatttccaaatcaat
ggtaagaaaaaatggatcccgatggcaacagaagaaccatctgttattgcagctgcaagc
aatggcgcaaaaatctgtggaaatatctgtgcagaaacacctcaacggctgatgcgcgga
caaatcgttctatcaggaaaatcggagtatcaagcagtgatcgatgcagtgaatcatcga
aaagaagaactgattctttgtgcaaatgaaagctatccttccatcgtgaaacgcgggggt
ggtgttcaagatatctctacacgggaatttatgggaagtttccatgcctacctatctatt
gattttttagtggatgtaaaagatgcaatgggggccaacatgatcaactcgatccttgag
agtgtagcaaacaaattacgggaatggttccctgaggaagagattctattcagtatttta
agtaattttgctacagaatcgttggcttctgcttgttgtgaaatcccctttgaacgctta
ggaagaagtaaagaaattggtgaacaaatcgctaaaaaaatccagcaagcaggggagtat
gcgaagctggatccgtatcgtgcagcgacgcataataaaggaatcatgaatggtatagaa
gctgtagtagcagctacaggaaatgatacacgtgcggtaagtgcttcgatccatgcctat
gcggcaagaaacggattataccaaggattgacagactggcagattaaagaaaataaacta
gttgggaagttaacggtgcctttggctgtggctacagtaggcggagcttctaatatcttg
ccaaaagctaaagtatccttggctatgctagatgttgattcagccaaggaactagcacaa
gtaatggctgctgtagggttagctcaaaatcttgctgctttgcgagcattagttacagaa
ggaatccaaaaaggacacatggggcttcaagctcgttcattagcaatctcaattggggca
gttggtgaggaaatcgagcaagttgcgcaaaaattacgtgaagcagaaaagatgaatcag
cagacagctatacagctattggataaaatccgggaaaaataa

DBGET integrated database retrieval system