KEGG   Enterococcus faecium T110: M395_08600Help
Entry
M395_08600        CDS       T03257                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
eft  Enterococcus faecium T110
Pathway
eft00330  Arginine and proline metabolism
eft00380  Tryptophan metabolism
eft00627  Aminobenzoate degradation
eft00643  Styrene degradation
eft01100  Metabolic pathways
eft01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eft00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    M395_08600
   00360 Phenylalanine metabolism
    M395_08600
   00380 Tryptophan metabolism
    M395_08600
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    M395_08600
   00643 Styrene degradation
    M395_08600
Enzymes [BR:eft01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     M395_08600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AII39469
Position
complement(1756126..1757613)
Genome map
AA seq 495 aa AA seqDB search
MWENNRGKKEDNMKDATELAKGLKEKEFSFQELADDVQKKIKKQNHELNAFVALEPFENS
STERLIPQSEKGPLAGIPFPLKMLGQEKKGWLATSGSRLFEIHRASHTSNYVQQAEAIGL
VPFGQTNAPEFGFKNITDPVIYGPARNPWNLECTPGGSSGGAAAAVSAGIVPLAGASDGG
GSIRIPASFCGLIGLKPSRGTMPVGPYAWRGWQGAAIDFGLTVSMRDTEALFYGMRSIHT
GAPYQVSPVEWQTHPRKKRLKIAFCIDSPIHSQISEEAVLAVKKAVDFLEKEGHDLTEIP
YPLDGRKLITSYYQMNGAETAAMIHSIETGIQRTVRKEELEPISWTLFQYGQKLSAATYI
DSLHVWDDAAIVMENLHHEYDLFLSPTTAFTAPKISEDLQSDTIRAQMEHIHDCSEVQAL
EVVSSMFEESLKITPYTQLANLTGQPAISLPTHLTKENMPLGIQFMSARGREDLLLQIGY
LFEASHQFHLPNPWK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
ttgtgggaaaataacaggggcaaaaaggaggataatatgaaagatgcaacagaattagcg
aaaggacttaaagaaaaagaatttagttttcaagaattagctgatgatgtacagaaaaaa
ataaagaaacaaaatcatgaattgaatgcgtttgttgcacttgaaccattcgagaatagt
tccactgaacgattgattccccagtcggaaaaaggaccattggcaggtattccattccct
ttaaaaatgctcggtcaagaaaaaaagggatggcttgctacttcaggatctcgtttattt
gaaatacatcgagcttctcatacatccaattatgtacagcaagcagaagcgatagggcta
gttccttttggacaaaccaatgcgccagagtttggtttcaaaaatattacagaccccgtc
atctatggaccagcaagaaacccctggaaccttgaatgtacaccgggcggatcaagtgga
ggcgctgctgctgcagtttcagcgggaatcgttcctttagctggcgctagtgatggtggt
ggttctattagaatacccgcttcgttttgcggattgattggcctgaaaccttcgcgaggg
acgatgccagttggtccatatgcttggcgaggatggcaaggagctgctattgatttcggt
ttgacggtttctatgagagacacggaagctttattttatggaatgagaagcatccacacc
ggtgcgccatatcaagtatcgccagttgagtggcaaacacatccaagaaaaaaacgtttg
aagatagctttttgtatcgattcaccgatccactcacagattagtgaagaggcagtactt
gctgtaaaaaaagctgtagatttccttgaaaaagaaggacatgatttgacggagattcct
tacccactagatggtcgtaaattgatcacgtcttattatcagatgaatggcgcagagaca
gcagcaatgatccactcgattgaaacaggcatccagcgaactgtcagaaaagaagaactt
gagccgatctcttggactttgttccaatatggtcagaaactttctgccgctacttacatt
gattctctgcatgtatgggatgatgcagcaattgtgatggaaaacttgcatcatgaatat
gatttattcctttcaccaacgactgcatttactgcccctaaaatcagcgaagatttgcaa
agtgatacgataagagcacagatggaacacatccatgattgttctgaagtacaagcttta
gaagttgtttcttctatgtttgaggaaagcttgaagatcacgccttatacacaattggct
aatctgactggacaaccagcaatcagcttgcctactcatttgacaaaagaaaacatgcct
ctcgggattcaatttatgtccgccagaggaagagaagatttgctgcttcaaatcggctat
ctatttgaagcaagtcaccagttccatttaccaaatccatggaaatag

DBGET integrated database retrieval system