KEGG   Enterococcus faecium T110: M395_10680Help
Entry
M395_10680        CDS       T03257                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
eft  Enterococcus faecium T110
Pathway
eft00561  Glycerolipid metabolism
eft00640  Propanoate metabolism
eft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    M395_10680
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    M395_10680
Enzymes [BR:eft01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     M395_10680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase Bcr-Abl_Oligo
Motif
Other DBs
NCBI-ProteinID: AII39762
Position
2154427..2155530
Genome map
AA seq 367 aa AA seqDB search
MSQSVFLPNYTIGTDAYEKANGIVKEYGKKVVLIGGKTALSKAESKIKAALTQEIEVIAS
LWYGGNSTYGNIEQLIQHESVQKADVLFAVGGGRACDTVKVIGEKLAKPVFTFPTIGSNC
SPVTAVCVIYNEEGVMDGLFFPSKPPVHTFIDTAIIAEAPDKYLWAGIGDALSKEVESTF
SARGDNLGYTDRLGIQIGKMCIDRLLTYGTQALKDSADNRPSYAIEQVVSDIIVTTGLVS
VLVNNNYNSAMAHSFYYGTTVLEKMEGYLHGASVSYGVLTLLMMDQQFDLFNKIYVFMKK
NQLPVSLTDMNLNVTTDLEAILDKAMTTNDIKHVPYEISREKFKQAILDVETYHATQESQ
QGYKKIS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaagtgttttcttaccaaattataccattggaacagatgcgtatgaaaaagca
aatggaatcgtcaaagaatatgggaaaaaagtagtgctgattggagggaagactgcactt
tcaaaggcagaaagcaaaataaaagcagctttgactcaggaaatagaagttatcgccagt
ctctggtacgggggtaattcaacttatggaaatattgaacagttgatccagcatgaaagt
gtccaaaaagcagacgtcctgtttgcagtcggcggtggccgtgcttgcgatactgtaaaa
gtcattggtgaaaaactagctaaaccagtcttcaccttccccactattggttcgaactgt
tcgcccgtcactgcggtatgtgtcatctataacgaagaaggcgtaatggacggactcttc
tttccttcaaaaccacctgtacacaccttcattgatacagcaattattgccgaagcacct
gataaatacttatgggcaggtattggcgatgctttatccaaagaagtcgaatctactttt
tctgctcgtggcgataatctaggctacacggatagattaggaatccaaatcggaaaaatg
tgcattgatcgtctcttgacttatggtacgcaagcattgaaagatagtgccgacaatcgt
ccctcatatgcaattgaacaagtcgtttcggatatcattgttactaccggattggtttct
gttttagttaacaataactataattctgctatggcacactcattctattacggtacgact
gttctagaaaaaatggagggataccttcacggagcatctgtcagttatggtgtactgacc
ttattgatgatggatcagcagttcgatttgtttaataaaatctatgtgtttatgaaaaag
aaccaacttccagtatcgttaaccgacatgaatctcaatgtcacgaccgatttagaagca
atcttagataaagccatgaccacaaatgatattaaacatgtgccttatgaaatctcccga
gaaaaatttaaacaggccattcttgacgtagaaacttatcatgctacacaagaaagccag
caaggatataagaaaatcagttaa

DBGET integrated database retrieval system