KEGG   Enterococcus faecium DO: HMPREF0351_12271Help
Entry
HMPREF0351_12271  CDS       T02120                                 

Gene name
gldA
Definition
(RefSeq) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
efu  Enterococcus faecium DO
Pathway
efu00561  Glycerolipid metabolism
efu00640  Propanoate metabolism
efu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HMPREF0351_12271 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF0351_12271 (gldA)
Enzymes [BR:efu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     HMPREF0351_12271 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase Bcr-Abl_Oligo
Motif
Other DBs
NCBI-GeneID: 13000979
NCBI-ProteinID: YP_006376877
UniProt: I3U4F7
Position
2217764..2218873
Genome map
AA seq 369 aa AA seqDB search
MNMSQSVFLPNYTIGTDAYEKANGIVKEYGTKVVLIGGKTALSKAENKIKVALTQEIEVV
ASLWYGGNSTYGNIEQLIQHESVQKADVLFAVGGGRACDTVKVIGEKLAKPVFTFPTIGS
NCSPVTAVCVIYNEEGVMDGLFFPSKPPVHTFIDTAIIAEAPDKYLWAGIGDALSKEVES
TFSARGDDLGYTDRLGIQIGKMCIDRLLTYGTQALKDSADDRPSYAIEQVVSDIIVTTGL
VSVLVNNNYNSAMAHSFYYGTTVLEKMEGYLHGASVSYGVLTLLMMDQQFDLFDKIYVFM
KKNQLPVSLTDMNLNVTTDLEAILDKAMATNDIKHVPYEITREKFKQAILDVETYHATQE
SQQGYKKIS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgagtcaaagtgttttcttaccaaattataccattggaacagatgcgtatgaa
aaagcaaatggaatcgtcaaagaatatgggacaaaagtagtgctgattggagggaagact
gcactttcaaaggcagaaaacaaaataaaagtagctttgacacaggaaatagaggttgtc
gccagtctctggtacgggggtaattcaacttatggaaatattgaacagttgatccagcat
gaaagtgtccaaaaagcagacgtcctgtttgcagtcggtggtggccgtgcttgcgatact
gtaaaagtcattggtgaaaaactagctaaaccagtcttcacctttcccactattggttcg
aactgttcgcccgtcactgcggtatgtgtcatctataacgaagaaggcgtaatggacgga
ctcttctttccttcaaaaccacctgtacacaccttcattgatacagcaattattgccgaa
gcacctgataaatacttatgggcaggtattggcgatgctttatccaaagaagtcgaatct
actttttctgctcgtggcgatgatctaggctacacggatagattaggaatccaaatcgga
aaaatgtgcattgatcgtctcttgacttatggtacgcaagcattgaaagatagtgccgac
gatcgtccctcatatgcaattgaacaagtcgtttcggatatcattgttactaccggattg
gtttctgttttagttaacaataactataattctgctatggcacactcattctattacggt
acgactgttctagaaaaaatggagggataccttcacggagcatctgtcagttatggtgta
ctgaccttattgatgatggatcagcagttcgatttgtttgataaaatctatgtgtttatg
aaaaagaaccaacttccagtatcgttaaccgacatgaatctcaatgtcacgaccgattta
gaagcaatcttagataaagccatggcaacaaatgatattaaacatgtgccttatgaaatc
acccgagaaaaatttaaacaggccattcttgacgtagaaacttatcatgctacacaagaa
agccagcaaggatataagaaaatcagttaa

DBGET integrated database retrieval system