KEGG   Enterococcus faecium DO: HMPREF0351_12353Help
Entry
HMPREF0351_12353  CDS       T02120                                 

Gene name
groEL
Definition
(RefSeq) chaperone GroEL
  KO
K04077  chaperonin GroEL
Organism
efu  Enterococcus faecium DO
Pathway
efu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:efu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HMPREF0351_12353 (groEL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:efu03019]
    HMPREF0351_12353 (groEL)
   03110 Chaperones and folding catalysts [BR:efu03110]
    HMPREF0351_12353 (groEL)
   03029 Mitochondrial biogenesis [BR:efu03029]
    HMPREF0351_12353 (groEL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:efu04147]
    HMPREF0351_12353 (groEL)
Messenger RNA biogenesis [BR:efu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     HMPREF0351_12353 (groEL)
Chaperones and folding catalysts [BR:efu03110]
 Heat shock proteins
  HSP60 / Chaperonin
   HMPREF0351_12353 (groEL)
Mitochondrial biogenesis [BR:efu03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    HMPREF0351_12353 (groEL)
Exosome [BR:efu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HMPREF0351_12353 (groEL)
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0351_12353 (groEL)
  Exosomal proteins of breast cancer cells
   HMPREF0351_12353 (groEL)
  Exosomal proteins of colorectal cancer cells
   HMPREF0351_12353 (groEL)
  Exosomal proteins of bladder cancer cells
   HMPREF0351_12353 (groEL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 13001062
NCBI-ProteinID: YP_006376959
UniProt: Q3XYG1
Position
complement(2298540..2300165)
Genome map
AA seq 541 aa AA seqDB search
MAKELKFAEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKEIE
LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIE
LATKAAVEELHNISTVVDSKEAIAQVAAVSSGSDKVGHLIADAMEKVGNDGVITIEESKG
IETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQILQ
QSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVIT
DDLGLELKDVTIENLGNASKVVVDKDNTTIVEGSGEKEAIEARVQLIKNQIAETTSDFDR
EKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNV
ISKVSAVEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDKLKNVELGTGFNAATG
EWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPAAPAAPAMDPSMMGGM
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaattgaaatttgcagaagacgcacgcgcagctatgttacgcggggtagat
aaattagcagatacagtgaaagtaacattaggacctaaaggccgaaatgtcgtactagaa
aaatcttacggctctccattgatcacaaatgatggtgtgacgatcgcaaaagaaatcgaa
ttagaagatcattttgaaaacatgggtgcaaaacttgtatcagaagtagcatcaaaaaca
aatgatattgcaggagacggtacaacgacagcaactgttctgacacaagcaatcgttcgc
gaaggtttaaaaaacgtaactgcaggtgctaatcctctaggcattcgtcgcgggatcgaa
ttggcaacaaaagcagcagtcgaagaattgcataatatctcaactgttgttgattcaaaa
gaagccattgcacaagtagcagctgtttcttcgggttctgataaagttggacatttgatt
gctgatgcaatggaaaaagttggaaacgacggtgtcatcacaatcgaagaatcaaaaggg
atcgaaacagaactagatgttgtagaaggtatgcagtttgatcgtggttacttatcacaa
tatatggtaacagataacgacaaaatggaagctgttctagaaaacccatatatcttgatc
acagacaaaaaaatctctaacatccaagatattctgccattgttagaacaaatcttgcaa
caatcacgtccattgttgattattgctgacgatgtagatggtgaagcattgccaactctt
gtattgaacaaaatccgtggaacattcaacgtagtagctgtaaaagctcctggtttcggc
gatcgtcgtaaagcaatgcttgaagatatcgctattttgacaggtggtacagtaattact
gacgatctaggtttagaattgaaagatgtaacaatcgaaaacttaggaaatgcttctaaa
gttgttgtagataaagacaatacaacgatcgtagaaggttctggagaaaaagaagcaatc
gaagctcgtgtgcaattgatcaaaaaccaaattgctgaaacaacttctgattttgaccgc
gaaaaattacaagaacgcttagctaaattagcaggtggtgtagctgttgttaaagttggt
gcagctactgaaacagaattgaaagaattaaaattacgcattgaagatgcattgaatgct
acacgtgccgcagtagaagaaggaatggtctcaggtggtggtacagctctagtgaacgtt
atcagcaaagtttctgctgtagaagcagaaggagacgtggcaacaggtatcaagatcgtt
gttcgtgctttagaagaaccaattcgtcaaatcgctgaaaacgctggttatgaaggatca
gtgattgttgataaattgaagaacgtggaactaggcactggtttcaatgctgctactgga
gaatgggtaaacatggttgaagcaggtatcgtagacccaactaaagtaacacgttctgcc
ttgcaaaatgccgcttccgtttctgccttgttattaacgacagaagcagtcgttgcagat
aaaccagaaccagcagcgccagcagctcctgcaatggatccatcaatgatgggcggtatg
atgtaa

DBGET integrated database retrieval system