KEGG   Enterococcus faecium DO: HMPREF0351_12415Help
Entry
HMPREF0351_12415  CDS       T02120                                 

Gene name
rluD2
Definition
(RefSeq) 23S rRNA pseudouridylate synthase RluD
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
efu  Enterococcus faecium DO
Brite
KEGG Orthology (KO) [BR:efu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:efu03009]
    HMPREF0351_12415 (rluD2)
Enzymes [BR:efu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     HMPREF0351_12415 (rluD2)
Ribosome biogenesis [BR:efu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    HMPREF0351_12415 (rluD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 Rad60-SLD S4_2
Motif
Other DBs
NCBI-GeneID: 13001125
NCBI-ProteinID: YP_006377021
UniProt: I3U4V1
Position
complement(2355725..2356648)
Genome map
AA seq 307 aa AA seqDB search
MPLLVRIDMQFTWDYEKDHSQQVKYFLKEKGISKGLLAKIKFQGGQIKVNDQVENVLFSL
AKDDKVTIVIPAEGEHETVLLDETPIDIVYEDEHVLVVNKPAGVSSIPAQYHPNGTMANR
VKAYYKKQGYENQVIHVVTRLDRDTSGLMLFAKHGFAHAKLDMQLREKKFVKKYQALVSG
RLSDLSAHGHIDLPIARDYSSLLKRMVSDEGRSAQTEYWIEKRLTEIALVDIQLHTGRTH
QIRVHFSAIGCALLGDDMYGGRMDLGIKRQALHCYDLRFYHPFTEELLEFKQPLAADMEA
VVRRFEE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcctttattagtgaggattgatatgcagtttacatgggattatgagaaagatcattct
cagcaagtaaaatattttttaaaagaaaaagggatctcaaagggtctgttagcgaaaata
aaatttcaaggcggtcaaatcaaagttaatgatcaagtagaaaatgtcttgttttctcta
gctaaggatgataaggtaaccattgtgattcctgctgaaggagaacatgaaaccgtactt
ttggatgaaacaccgatcgatatcgtgtatgaagatgaacacgttctggtagtaaataaa
ccagcaggcgtttcgtctattcctgcccaataccatccaaatgggacaatggctaatcgt
gtaaaggcttattataaaaaacaaggttacgaaaaccaagtaatccatgtggtgacgcga
ctagatcgggatacatctggcttgatgctttttgcaaagcatggatttgcgcacgcaaaa
ttagatatgcaacttcgtgaaaagaagtttgtgaaaaaatatcaggccttagtcagtgga
aggctttcagatttatcggcacatggacatatcgatttgccgatcgcccgagattattct
tcgctattgaagcgaatggtctctgatgaaggacgttcggcacagactgagtactggata
gagaagcgactaacagaaatcgcgttagttgatatccagctgcatacaggaaggacacat
caaataagagttcatttttccgcaattggctgtgccctgctcggtgatgatatgtatggc
gggcgaatggatctgggaataaaaagacaagcccttcattgttatgatctgcgtttttac
catccatttacagaagagttgctggagttcaagcagcctttagccgcagacatggaggca
gttgtgagacggtttgaagaataa

DBGET integrated database retrieval system