KEGG   Enterococcus faecium DO: HMPREF0351_12609Help
Entry
HMPREF0351_12609  CDS       T02120                                 

Gene name
proB
Definition
(RefSeq) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
efu  Enterococcus faecium DO
Pathway
efu00330  Arginine and proline metabolism
efu00332  Carbapenem biosynthesis
efu01100  Metabolic pathways
efu01130  Biosynthesis of antibiotics
efu01230  Biosynthesis of amino acids
Module
efu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HMPREF0351_12609 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HMPREF0351_12609 (proB)
Enzymes [BR:efu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HMPREF0351_12609 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase GTP1_OBG
Motif
Other DBs
NCBI-GeneID: 13001347
NCBI-ProteinID: YP_006377215
UniProt: Q3Y157
Position
2590804..2591610
Genome map
AA seq 268 aa AA seqDB search
MRKEIKNAKRIIVKVGTSTLIYPNGNINLAAIDQLAFVLSDLRNRGKEVILVSSGAVGVG
MHKLHLSERPTLIPEQQAAAAVGQAELMNIYNQRFSVYNQQTAQILVTRDVVDYPESRKN
VRNTLEQLLIMDTIPIVNENDTVAVDELDHLTKFGDNDQLSAIMAKLVAADLLIVLSDID
GFYSDNPTTNPEAQMYRYIDKIDEKILAQAGGAGSTFGTGGMQSKLKAASRIFEANSAMI
LANGKNPAIIFDILAGKEVGTLFKEDLK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagaaattaaaaatgcaaaacgaattattgtcaaagtaggaacaagtacattg
atttatcccaatggaaatatcaatcttgcggcaatcgatcagttagcttttgtcctttct
gatcttagaaatcggggaaaggaagtgatcttagtctcatcaggagctgtaggcgttggt
atgcataaattacatttgtcagaacgtccgactttgattcctgaacagcaagctgcggcg
gctgttggtcaagccgaactgatgaatatctataatcaaagattcagtgtatataatcaa
cagacggcacagatcctcgtgacaagagacgtggtagattatcctgaaagtcgtaaaaat
gtgaggaatacattggaacagcttttgattatggacacgatccctatcgtgaacgaaaac
gatactgtagcagtggatgaattagatcatctgacaaaatttggcgataatgatcagctg
tcagccatcatggcaaaacttgtcgcggcagaccttttgatcgtcctttctgatatcgac
gggttttattcagataatccgactacaaatcccgaggctcagatgtatcgctatatcgat
aaaatcgatgaaaagattctggcacaagcaggtggtgctggtagcacatttggaacaggc
ggtatgcagagtaaattaaaagccgcttctaggatatttgaagcaaacagcgcaatgatt
ttagcaaatggaaaaaatccggcaattatttttgatattcttgcaggaaaagaagtaggt
actttatttaaggaggacttgaaatga

DBGET integrated database retrieval system