KEGG   Erythrobacter flavus: CHH26_00295Help
Entry
CHH26_00295       CDS       T04986                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
efv  Erythrobacter flavus
Pathway
efv00071  Fatty acid degradation
efv00072  Synthesis and degradation of ketone bodies
efv00280  Valine, leucine and isoleucine degradation
efv00310  Lysine degradation
efv00362  Benzoate degradation
efv00380  Tryptophan metabolism
efv00620  Pyruvate metabolism
efv00630  Glyoxylate and dicarboxylate metabolism
efv00640  Propanoate metabolism
efv00650  Butanoate metabolism
efv00900  Terpenoid backbone biosynthesis
efv01100  Metabolic pathways
efv01110  Biosynthesis of secondary metabolites
efv01120  Microbial metabolism in diverse environments
efv01130  Biosynthesis of antibiotics
efv01200  Carbon metabolism
efv01212  Fatty acid metabolism
efv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:efv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHH26_00295
   00630 Glyoxylate and dicarboxylate metabolism
    CHH26_00295
   00640 Propanoate metabolism
    CHH26_00295
   00650 Butanoate metabolism
    CHH26_00295
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHH26_00295
   00072 Synthesis and degradation of ketone bodies
    CHH26_00295
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHH26_00295
   00310 Lysine degradation
    CHH26_00295
   00380 Tryptophan metabolism
    CHH26_00295
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHH26_00295
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CHH26_00295
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CHH26_00295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:efv04147]
    CHH26_00295
Enzymes [BR:efv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CHH26_00295
Exosome [BR:efv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHH26_00295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASP28869
UniProt: A0A222EQS7
Position
complement(61924..63102)
Genome map
AA seq 392 aa AA seqDB search
MRDAVIVSTARTAIGRAYKGGFNDTKGPTLGAYSLKPAIERAGIDAGEVDDVLWGSALQQ
GTQAGNLARQVALRAGCPIGTSGMTIDRQCSSGLMSIATAAKQIITDRMDVVAAGGQESI
SLVQTKEMRVMPDPELVNMHGAIYMPMLQTAETVAQRYGISREAQDEYALQSQQRTAAAQ
EAGLFDDEIVPVSTTHKVQNKETGEISDVEITIAKDEGNRPQTTLEGLSSLQPVMGPDTT
ITAGNASQLSDGSSASILMEAKVAEKKGLTPLGRYVGMAVAGTEPDEMGIGPVFAIPKLL
ERFDLKVDDIGLWELNEAFAVQVLYCRDKLGIPGELLNVNGGSISIGHPYGMTGARCVGH
TLIEGKRRGAKYGVVTMCVGGGMGAAGLFEIF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacgcagtcatcgtctccaccgcccgcaccgccatcggccgtgcctacaagggc
gggttcaacgacaccaagggcccgacgctcggcgcctattcgctcaagcccgcaatcgaa
cgtgccggcattgatgccggcgaagtcgacgacgtgctgtggggcagtgcgctccagcag
ggcacgcaggcaggcaacctcgcgcgccaggtcgcgttgcgcgccggctgcccgatcggc
accagcggcatgaccattgaccgccagtgctcgagcggcctgatgagcattgccaccgcg
gccaagcagatcatcaccgaccggatggacgtggtcgccgcaggcggccaagaatcgatc
agcctcgtgcagaccaaggaaatgcgcgtgatgcccgatcccgagctggtgaacatgcac
ggcgcgatctacatgccgatgctgcagaccgccgaaacagtcgcgcagcgctatggcatc
agccgcgaagcgcaggacgaatacgccctccagagccagcagcgtaccgctgcggcgcag
gaagcgggcctgttcgacgatgaaatcgtccccgtcagcaccacgcacaaggtgcagaac
aaggaaaccggcgaaatctcggatgtcgagatcaccatcgccaaggacgagggcaaccgc
ccgcagaccacgctcgaaggcctttccagcctgcagccggtgatgggccccgataccacg
atcactgcgggcaatgcctcgcaattgtcggacggttcgtcggcctcgatcctgatggaa
gccaaggtcgccgagaagaagggcctgaccccgctcggccgctatgtcggcatggcggtt
gcgggcaccgaacccgatgaaatgggcatcggcccggtcttcgctattcccaagctgctc
gaacgcttcgacctcaaggtcgacgacatcggcctgtgggaactgaacgaagccttcgcg
gtgcaggtgctctactgccgtgacaagctgggcatcccgggcgaactgctcaacgtcaac
ggcggctcgatttcgatcggccacccctacggcatgaccggcgcgcgctgcgtcggccac
acgctgatcgaaggcaagcgccgcggtgccaaatacggtgtcgtcaccatgtgtgtcggc
ggtggcatgggcgcagccggcctgttcgagatcttctag

DBGET integrated database retrieval system