KEGG   Erythrobacter flavus: CHH26_03570Help
Entry
CHH26_03570       CDS       T04986                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
efv  Erythrobacter flavus
Pathway
efv00010  Glycolysis / Gluconeogenesis
efv00071  Fatty acid degradation
efv00350  Tyrosine metabolism
efv00625  Chloroalkane and chloroalkene degradation
efv00626  Naphthalene degradation
efv00680  Methane metabolism
efv01100  Metabolic pathways
efv01110  Biosynthesis of secondary metabolites
efv01120  Microbial metabolism in diverse environments
efv01130  Biosynthesis of antibiotics
efv01200  Carbon metabolism
efv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHH26_03570
  09102 Energy metabolism
   00680 Methane metabolism
    CHH26_03570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHH26_03570
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CHH26_03570
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CHH26_03570
   00626 Naphthalene degradation
    CHH26_03570
Enzymes [BR:efv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CHH26_03570
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     CHH26_03570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ASP29421
UniProt: A0A222ESM3
Position
715363..716475
Genome map
AA seq 370 aa AA seqDB search
MKTRAAVAFAPKQPLEIVELDLEGPKAGEVLVEIMATGICHTDAYTLDGHDSEGIFPSVL
GHEGAGIVREVGAGVTSVKPGDHVIPLYTPECRQCKSCLSGKTNLCTAIRATQGQGLMPD
GTTRFSYKGEPIFHYMGCSTFSNFTVLPEIAVAKIREDAPFQTSCYVGCGVTTGVGAVTN
TAKVQVGDNVVVFGLGGIGLNVIQGARLAGAGMIVGIDINSDREEWGRKFGMTHFLNTKG
MSRDEIVAKVVEMTDGGADYTFDCTGNTEVMRTALEACHRGWGTSIVIGVAEAGKEIATR
PFQLVTGRNWRGTAFGGAKGRTDVPKIVDWYMDGKIEIDPMITHVLSLEEINKGFDLMHS
GESIRSVVVF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgcgccgccgtcgcctttgcccccaagcaaccgctcgaaatcgtcgagctg
gacctcgaagggcccaaggcgggcgaagtgctggtcgagatcatggccacgggcatctgc
cataccgacgcctacacgctcgacgggcacgacagcgagggcatcttcccctcggtgctc
ggccatgaaggcgccggtatcgtgcgtgaagtcggcgccggcgtgaccagcgtgaagccg
ggcgaccatgtcatcccgctctacacgcccgagtgtcgccagtgtaaatcgtgcctcagc
ggcaagaccaatctgtgtaccgcgatccgggccacgcagggccaggggctgatgcccgac
gggaccacgcgcttttcctacaagggcgagccgatcttccattacatgggctgctcgacc
ttctcgaacttcaccgtcctgccggaaatcgcggtcgccaagatccgcgaagacgcgccc
ttccagacaagctgctacgtcggctgcggcgtcaccaccggggtcggcgcggtgaccaac
accgccaaggtgcaggtgggcgacaatgtcgtggtgttcggcctcggcgggatcgggctc
aacgtcatccagggcgcgcggctggccggggcggggatgatcgtgggtatcgacatcaat
tccgaccgcgaggaatgggggcgcaagttcggcatgacccacttcctcaacaccaagggc
atgagccgcgacgaaattgtcgccaaggtggtcgaaatgaccgatggcggcgccgattac
accttcgactgcacgggcaacaccgaggtcatgcgcaccgcgctcgaggcatgtcatcgc
ggttggggtacctcgatcgtcatcggcgtggccgaggcgggcaaggaaattgccacgcgt
ccgttccagctggtgaccggacgcaattggcgcggcaccgccttcggcggagccaagggg
cgcaccgacgtgcccaagatcgtcgactggtacatggacggcaagatcgagatcgacccg
atgatcacccatgttttgtcgctcgaggaaatcaacaagggcttcgacctgatgcattcg
ggcgaaagcatccgcagcgtggtggtattctga

DBGET integrated database retrieval system