KEGG   Erythrobacter flavus: CHH26_06170Help
Entry
CHH26_06170       CDS       T04986                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
efv  Erythrobacter flavus
Brite
KEGG Orthology (KO) [BR:efv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CHH26_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ASP31634
UniProt: A0A222EZK7
Position
1238542..1238940
Genome map
AA seq 132 aa AA seqDB search
MKELFQHAATTDGITVRVAVNFLPEQSQPEAGKWFWVYHIRIENGSHERVQLKTRHWRIT
DGAGLVSHVDGEGVVGEQPVLMPGQSHDYVSGCPLDTPHGSMEGFYTFHAENGEPLEVRI
PFFPLAAPATAT
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
attaaggagcttttccagcatgccgccacgaccgacgggatcaccgtccgggtcgcggtc
aatttcctgcccgagcaatcgcagcccgaagcgggcaaatggttctgggtctatcacatc
cgcatcgagaacggctcgcacgaacgcgtccagctcaagacccgccactggcggatcacc
gatggggcgggtctggtcagccatgtcgatggcgaaggcgtggtcggcgaacagccggtg
ctgatgccggggcaaagccatgactacgtttcggggtgcccgctcgacacgccgcatgga
tcgatggaaggcttctacaccttccacgcggagaatggcgaaccgctcgaagtgcgcatt
cccttcttcccgctcgccgcgcctgcaaccgccacctga

DBGET integrated database retrieval system